KEGG   Anabaena sp. 90: ANA_C20345Help
Entry
ANA_C20345        CDS       T02341                                 

Definition
glutathione S-transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
anb  Anabaena sp. 90
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:anb00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ANA_C20345
Enzymes [BR:anb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ANA_C20345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
chANA02:complement(383946..384740)
Genome map
AA seq 264 aa AA seqDB search
MLELYQWELSQFSEKVRLLLDYKGLEYRKIEVAPGIGQLELFRLTGQKQVPVLKDGNRYI
ADSTEIAKYLDSEYPDRLLIPIDPKKRALTLLLEDWADESIGAKGRKALFAAISQDQSFR
KSLLPVSTPDILRSVIEGVPGDFLSALGFGVGFTPDVVNAAVTSLKQDLDIITQLLVGSP
YLTGDEPTLADLTVASLSMLLKFPDGAYLDLPVSLRGKGLSSIANNPDYEAFFAWRDRIY
SQFRNPLPGITPPGGNSPTSIQID
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctagaactatatcagtgggaactatctcaattttccgaaaaagttcgtttactctta
gattataaaggactggagtatcgcaaaatcgaagttgcaccaggcattggccagctagaa
ttatttcgcttgactggacaaaaacaagttccagtgttaaaagatggcaatagatatatt
gctgattctacagaaatcgctaaatatttagattcagaatacccagatcgtctgctgata
ccgatagatcccaaaaaacgcgctttgactttattattggaagattgggctgatgagtca
atcggtgctaaaggtagaaaggctctatttgcagctattagtcaagatcagagttttcgt
aagtcgttgttaccagtttccactccagatattctcagaagtgttatcgaaggtgttcct
ggtgattttctgtcagcgctgggttttggtgtcggttttacaccagatgtggtaaatgcg
gctgttactagcttaaaacaagatttggatattattacccaattgttggtaggtagtcct
tatttaacaggtgatgaaccaactttagctgatttaacagttgctagtttatcaatgctt
ttgaagtttcccgatggtgcttatttggatttaccagtatctctgagagggaaaggattg
tccagcatagccaataatcctgattatgaagcattttttgcttggcgcgatcgcatctat
tcacaatttagaaacccattaccaggaatcacaccacccggaggaaattcaccaacaagt
attcaaattgactaa

DBGET integrated database retrieval system