KEGG   Aspergillus niger: ANI_1_1008124Help
Entry
ANI_1_1008124     CDS       T01030                                 

Gene name
An14g07390
Definition
endo-1,4-beta-xylanase 5
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     ANI_1_1008124 (An14g07390)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 211 aa AA seqDB search
MKVTAAFASLLLTAFAAPAPEPVLVSRSAGINYVQNYNGNLGDFTYDESTGTFSMYWEDG
VSSDFVVGLGWTTGSSKSITYSAQYSASSSSSYLAVYGWVNSPQAEYYIVEDYGDYNPCS
SATSLGTVYSDGSTYQVCTDTRTNAPSITGTSTFTQYFSVRESTRTSGTVTIANHFNFWA
QHGFGNSNFNYQVMAVEAWNGAGSASVTISS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcactgcagcttttgcaagtctcttgcttacggccttcgcggcccctgctccg
gagcctgttctggtgtcgcgaagtgccggtatcaactacgtgcagaactacaacggcaac
cttggtgacttcacctacgacgagagtaccgggacattttccatgtactgggaggatgga
gtcagttccgacttcgtcgttggtttgggctggaccactggctcctctaaatctattacc
tactctgcccaatacagcgcttctagctccagctcctacctggctgtctacggctgggtc
aactctcctcaggccgaatactacatcgtcgaggattacggtgattacaacccttgcagc
tcggccacgagccttggtaccgtgtactctgatggaagcacctaccaagtctgcaccgac
actcggacgaacgcgccatctatcacaggaacaagcacgttcacgcagtacttctccgtt
cgtgaaagtacacgcacatccggaacagtgactatcgccaaccatttcaatttctgggcg
cagcatgggttcggcaatagcaacttcaattatcaggtcatggcggtggaggcatggaac
ggtgctggcagtgccagtgtcacgatatcttcttaa

DBGET integrated database retrieval system