KEGG   Aspergillus niger: ANI_1_1044064Help
Entry
ANI_1_1044064     CDS       T01030                                 

Gene name
An07g08380
Definition
histone deacetylase HOS2
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ANI_1_1044064 (An07g08380)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MARSAIVQEYAPPSSAPTFSVDRKVTHERQQNGISRPNGYRVSWHANPAVEPHHFGQSHP
MKPWRLTLTKQLVMAYGMHHAMDLYLARAATYEELADFHKSDYLDFLQQVVPGDMENPEQ
SENIARFNFGDDCPIFDGLYNYCSLYAGGTIDAARKLCNNQSEIAVNWSGGLHHAKKAEA
SGFCYINDIVLGILQLLRLHPRVMYIDIDVHHGDGVEQAFWSTDRVLTVSFHKYDKDNFF
PGTGGLDSTGPTHPLNPGAHHSVNVPLHDGIDDESYIQLFRDVVGSCVEVYRPGAIVLQC
GADSLGCDRLGCFNLNVAAHGACVAFVKTFNLPLLVVGGGGYTPRNVSRAWAHETSILID
AQDTIDPHIPETVTFRNHFGPDFSLFPPLSEMRKLENKNPRTYLAGLLQSIREQLRYIQG
APSVQMSFIPPDILGLREDTEKEIEEETAMMEEEREERSGGGSLGKSSRRRDLERGAGQR
GELF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctccgccattgtccaagaatacgcccctccgtcctccgcacccaccttctcc
gtcgaccgcaaagtcacccacgagcgccaacaaaatggcatttctcgccccaatggatat
cgcgtctcctggcatgccaatcccgccgtcgaaccacaccactttggccagtcccatccc
atgaagccatggcgtctgaccctcacaaaacagctggtcatggcctacggcatgcaccat
gcgatggacctctacctggcgcgcgcagccacctacgaagagctggcggacttccacaaa
tcagattacctcgatttcctacagcaagtcgtccccggcgatatggagaatcctgaacag
agcgagaacatcgcgcgcttcaacttcggtgacgattgccccatcttcgacggcctctac
aactactgctccctctacgccggcggtaccatcgacgcagcccgaaagctctgcaacaac
cagtcggagatcgcagtcaactggtctggtggcctacatcacgccaaaaaagccgaagcc
agcggtttctgctacatcaacgacatcgtcctcggcatcctgcagctcctccgcctgcac
ccgcgcgtcatgtacatcgacatcgacgtccaccacggcgacggcgtggaacaagccttc
tggtccaccgaccgcgtcctcaccgtctccttccacaaatacgacaaggacaacttcttc
cccggcaccggtggcctcgacagcacggggcccacccatcccctcaacccgggcgcccac
cactccgtcaacgtccccctccacgacggcatcgacgacgaatcctacatccaactcttc
cgcgacgtcgtcggctcctgcgtcgaagtctaccgaccgggcgccatcgtcctccaatgc
ggtgccgactccctcggctgcgaccgtctcggctgcttcaacctgaacgtcgccgcccac
ggcgcctgcgtcgccttcgtcaaaacttttaacctccctctcctcgtcgtcggtggcggt
ggctacaccccacgcaacgtctcccgcgcctgggctcacgaaacctccatcctcatcgac
gcccaggataccatcgaccctcacatccccgaaaccgtcaccttccgcaaccacttcggc
cctgacttctctctctttccgcccctctcggaaatgcgcaagctcgaaaacaagaaccct
cgcacttatctcgccggcttgctccagtccatccgcgaacagcttcgatacatccaaggt
gccccgagcgtgcaaatgagcttcattcctccggatattctcggtcttcgcgaagacacg
gagaaggaaatcgaagaagagacagccatgatggaggaggagcgcgaggaacgatctggt
ggtggtagtttagggaagtcgagtcgacggagggatttggagagaggtgctgggcagcgg
ggggagctgttttaa

DBGET integrated database retrieval system