KEGG   Aspergillus niger: ANI_1_1086014Help
Entry
ANI_1_1086014     CDS       T01030                                 

Gene name
An01g08160
Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ANI_1_1086014 (An01g08160)
Transcription machinery [BR:ang03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     ANI_1_1086014 (An01g08160)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 403 aa AA seqDB search
MPSITDSAKRKASEEALSPDSHKKARTDSPEREPKTEDDLLDKPPRIVPFPEKPAVLEER
RGDIEFRVVNNDGSRDSFVVLTGLKCIFQKQLPKMPKDYIARLVYDRSHLSLAIVKHPLE
VVGGITYRPFNSRRFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSDIMHFLTYADNY
AIGYFKKQGFTKEITLDKSVWMGYIKDYEGGTIMQCTMLPKIRYLEVGRMLLKQKEAVHA
KIRAFSRSHIIHVPPKEWKNGPCKIDPLSIPAIKESGWSPDMDELARQPRHGPNYNQLLH
LLNDMQNHSAAWPFTQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDMYPTPQDFIKDAML
IFDNCRRYNNENTPYAKSANKLEKFMWQQIRNIPEWSHLADGH
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaatcacggatagtgccaagcggaaagcatcggaggaggcgctctccccagat
tcccataagaaggcgcgcactgactctcccgagagggaacccaagaccgaagatgacctc
ctggataagccaccgagaatcgttcccttcccggagaagcctgcagtactggaggaacgt
cgcggcgatatcgagtttcgtgtagtcaacaacgatggttcgcgcgacagttttgttgtc
cttacaggtctcaaatgtatctttcaaaaacagctcccgaagatgcccaaagattatatc
gcgcgattggtttacgacaggtcgcatctttccttggccatcgtcaaacaccctttagaa
gttgtgggagggatcacataccggccgttcaacagccgcaggttcgccgagatcgttttc
tgtgccatttcgtccgaccagcaggttaaaggatacggtgcgcacttgatgtcccatctc
aaggattatgtgaaagccacatcggacatcatgcatttcctgacctacgccgacaattac
gccattggttacttcaaaaaacaagggttcaccaaagagattactctcgacaagtccgtg
tggatgggatacatcaaagattacgagggtggtacaatcatgcagtgcaccatgctccct
aagatacggtacctcgaggttggccgcatgcttttaaagcaaaaagaagctgtacacgcg
aaaatccgggccttcagtcgctcacatataattcacgtgcccccaaaggaatggaagaat
ggtccgtgcaagatcgacccattaagtataccagctatcaaagagtcgggatggtcgccg
gacatggatgaactagcacgtcaaccacgccacggacccaactacaatcagctgctgcat
ctactcaacgacatgcagaaccacagcgcggcatggccctttactcagccagtcaatcgc
gacgaggttcctgactattacgaagtcattaaggagcccatggacttgtccaccatggaa
gagaagcatgagaaggacatgtaccctacgccgcaagattttattaaagacgctatgttg
atatttgataactgccggaggtacaacaacgagaacacgccctatgcaaagagtgccaat
aaattagagaaattcatgtggcaacagatacgaaatattccggagtggtcgcacttggcc
gatggtcactga

DBGET integrated database retrieval system