KEGG   Aspergillus niger: ANI_1_110174Help
Entry
ANI_1_110174      CDS       T01030                                 

Gene name
An10g00950
Definition
tannase subunit
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
ang  Aspergillus niger
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 581 aa AA seqDB search
MRKSTRAVVAALAAATAQATSLSDLCTVSNVQSALPSNGTLLGIDLIPSAVTANTVTDAS
SGMGSSGSYDYCNVTVTYTHTGKGDKVVVKYALPAPSDFKNRFYVAGGGGFSLSSDATGG
LEYGAASGATDAGYDAFSYSYDEVVLYGNGSINWDATYMFSYQALGEMTKIAKPLTRGFY
GLSSDKKIYTYYEGCSDGGREGMSQVQRWGDEYDGVIAGAPAFRFAQQQVHHVFPATIEH
TMDYYPPPCELDKIVNATIEACDPLDGRTDGVVSRTDLCMLNFNLTSIIGESYYCAEQNY
TSLGFGFSKRAEGSTTSYQPAQNGSVTAEGVTLAQAIYDGLHDSNGKRAYLSWQIAAELS
DGDTEYDSTTDSWTLSIPSTGGEYVTKFVQLLNIDNLENLDNVTYDTLVDWMNIGMIRYI
DSLQTTVVDLTTFQESGGKMIHYHGESDPSIPTASSVHYWQGVRQAMYPNTSYTQSLKEM
SDWYQLYLVPGAAHCGTNDLQPGPYPEDNMEIMIDWVENGNKPSRLNATVSSGTYAGETQ
MLCQWPSRPLWTSNSSFSCVHDSKSLATWDYTFDAFKMPVF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagtccactcgcgcagttgtcgctgctctggcagcagccactgcccaggctact
tccctgtccgatctctgcactgtttccaatgttcagtccgcccttccttctaacggcacc
ctcctgggcatcgacttgatcccctctgcagtcactgccaacactgtcaccgatgccagc
tctggcatgggcagctccggctcctacgactactgcaacgtcactgtcacctacacccac
accggcaagggtgacaaggttgtcgtaaagtacgccctgcccgctccttctgatttcaag
aaccgtttctacgtcgccggtggtggtggtttctccctctccagcgatgctactggcggt
ctcgagtacggtgctgcctcgggtgccaccgatgccggctacgacgccttctcctacagc
tacgatgaagttgttctgtacggcaacggctcgatcaactgggatgctacatacatgttc
agctaccaggctctgggtgagatgaccaagatcgccaagcccctgacccgcggcttctac
ggcctctccagcgacaagaagatctacacctactacgagggctgttccgatggtggtcgt
gagggtatgagtcaggttcagcgctggggagatgaatatgacggtgttattgccggtgcc
cctgccttccgctttgctcagcagcaggtccaccacgtcttccctgccaccattgaacac
accatggattactaccctcccccttgcgagcttgacaagatcgtcaacgctaccattgaa
gcctgtgaccctctcgacggccgtaccgatggcgttgtttcccgtactgacctctgcatg
ctgaacttcaatctcacctctattatcggcgagtcctactattgcgctgaacaaaactac
acctccctgggcttcggcttcagcaagcgcgccgaaggcagcactaccagctaccagcct
gcccagaacggcagcgtcaccgccgaaggtgttacccttgcccaggccatctacgacggt
ctccacgactctaacggcaagcgcgcctacctctcgtggcagatcgccgccgagctgtcc
gacggtgacacggagtacgattccaccactgactcctggactctgagcatcccctccacc
ggcggcgagtacgtgaccaagttcgtgcagctcctcaatattgacaacctggagaacctc
gataacgtcacctacgacaccctggtggactggatgaacatcggcatgatccgctacatt
gacagtctccagaccaccgtcgtcgacctcaccaccttccaggagtccggtggtaagatg
atccactaccatggtgaatccgaccccagtatcccgaccgcctcgtccgtccactactgg
cagggcgtccgtcaggccatgtaccccaacacctcctacacccagtccctgaaggagatg
tccgactggtaccagctttacctcgtccctggcgctgcccactgcggtactaacgacctc
cagccgggtccttaccccgaggacaacatggagatcatgatcgactgggttgagaacggc
aacaagccttcccgcctcaacgccaccgtctcctccggtacctatgctggtgagacccag
atgctctgccagtggccttcccgtcccctctggaccagcaactccagcttctcttgtgtc
catgactccaagtctcttgctacttgggactacacttttgacgctttcaagatgcccgtt
ttttaa

DBGET integrated database retrieval system