KEGG   Aspergillus niger: ANI_1_1110124Help
Entry
ANI_1_1110124     CDS       T01030                                 

Gene name
An14g01190
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ang  Aspergillus niger
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ang01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ang00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 296 aa AA seqDB search
MPANAITIIFSPYHVGIRDHRVGNGPHRIRQHGIIQALEDLGVKVNFIELDRVDEFEGEI
GRSFELLRRTSTAVTQAVKNNTFPIILSGNCMASAAVACGLNTDDLKFIYFDAHDDLDSP
DVNENGYLDAMGLSMLRGESWKTLTRTVPGYKPFTYDGNFLYCGLRDQSDVQRQRVFDAG
MVAIWGETERKVDFVGELSKQLEAKSYDPALVHLDLDVLDESYGKVNDYPSPGGLFESEL
LGCMDLVPRRSTPRSLTVCSFDPDAGDGDRIAVIAVRAVTSFVQSLLDTGALINDA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccaacgccatcaccatcatcttctcaccctaccacgtcggcatccgcgaccac
cgagttggcaacggcccccaccgcatccgccaacacggaatcatccaagccctcgaagac
ctaggcgtaaaagtcaacttcatcgaactcgaccgtgtcgacgaattcgaaggcgaaatt
ggtcgcagcttcgagctcctccgacgcacatctacggccgtcacccaagccgtgaaaaac
aacaccttccctatcatcctatcaggcaactgcatggcaagcgcagcggtagcctgcggt
ctcaacaccgatgatctgaaattcatctacttcgacgctcacgatgatctcgactcaccg
gacgtcaacgagaacggctatctcgacgcgatgggactttccatgctccgtggggagagc
tggaagactcttacgaggacggttccgggatacaagcctttcacttatgatggcaacttt
ttgtactgtgggctacgggatcagagcgatgttcagcgtcagagggtatttgatgcgggg
atggttgccatatggggtgaaaccgagcgtaaggttgattttgtgggtgagttgagtaag
cagttggaagcaaagtcgtatgatccggctttggtgcatttggatttggatgtattggac
gagtcatatgggaaggttaatgattatccttctcccgggggattatttgagtccgaattg
ttgggttgtatggatcttgtacctaggaggagtacgcctaggtctttgactgtctgttct
tttgatcctgatgcgggcgatggggataggattgcggtgattgctgttcgtgcggttact
tcttttgttcagtctttgttggatacaggggctttgattaatgatgcttaa

DBGET integrated database retrieval system