KEGG   Aspergillus niger: ANI_1_1120064Help
Entry
ANI_1_1120064     CDS       T01030                                 

Gene name
An07g08950
Definition
endo-beta-1,4-glucanase B
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ang  Aspergillus niger
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ang00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 331 aa AA seqDB search
MKFQSTLLLAAAAGSALAVPHGSGHKKRASVFEWFGSNESGAEFGTNIPGVWGTDYIFPD
PSTISTLIGKGMNFFRVQFMMERLLPDSMTGSYDEEYLANLTTVVKAVTDGGAHALIDPH
NYGRYNGEIISSTSDFQTFWQNLAGQYKDNDLVMFDTNNEYYDMDQDLVLNLNQAAINGI
RAAGASQYIFVEGNSWTGAWTWVDVNDNMKNLTDPEDKIVYEMHQYLDSDGSGTSETCVS
GTIGKERITDATQWLKDNKKVGFIGEYAGGSNDVCRSAVSGMLEYMANNTDVWKGASWWA
AGPWWGDYIFSLEPPDGTAYTGMLDILETYL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcagagcactttgcttcttgccgccgcggctggttccgcgttggctgtgcct
catggctccggacataagaagagggcgtctgtgtttgaatggttcggatcgaacgagtct
ggtgctgaatttgggaccaatatcccaggcgtctggggaaccgactacatcttccccgac
ccctcgaccatctctacgttgattggcaagggaatgaacttcttccgcgtccagttcatg
atggagaggttgcttcctgactcgatgactggttcatacgacgaggagtatctggccaac
ttgacgactgtggtgaaagcggtcacggatggaggcgcgcatgcgctcatcgaccctcat
aactatggcagatacaacggggagatcatctccagtacatcggatttccagactttctgg
cagaatctggcgggccagtacaaagataacgacttggtcatgtttgataccaacaacgaa
tactacgacatggaccaggatctcgtgctgaatctcaaccaagcagccattaacggcatc
cgcgctgcaggtgcaagccagtacattttcgtcgaaggcaactcctggaccggagcttgg
acatgggtcgatgtcaacgacaatatgaagaatttgaccgacccagaagacaagatcgtc
tatgaaatgcaccagtacctagactccgacggttccggcacttcggagacctgtgtctcc
gggacaatcggaaaggagcggatcactgatgctacacagtggctcaaggacaataagaag
gtcggcttcatcggcgaatatgccggggggtccaatgatgtgtgtcggagtgccgtgtcc
gggatgctagagtacatggcgaacaacaccgacgtatggaagggtgcgtcgtggtgggca
gccgggccatggtggggagactacattttcagcctggagcccccagatggaactgcttac
acgggtatgctggatatcctggagacgtatctctga

DBGET integrated database retrieval system