KEGG   Aspergillus niger: ANI_1_112094Help
Entry
ANI_1_112094      CDS       T01030                                 

Gene name
An11g00720
Definition
DNA polymerase delta subunit 4
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ang  Aspergillus niger
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ang00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ang00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ang03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ang03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ang03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ang03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ang03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 197 aa AA seqDB search
MPPSRRRGGNTAATRSNQATLSFGSKSRVTKPSAAPSTRSQKAKDLDLIDTTRSSTPSVE
DVSEAEQASVTPTEPSQPHVAELAVRKQAQTEIQQPRSEEDAKAEKITERQLQQYWKKEE
AKRQGPRVHQEGLELREKILRNFDLSSQYGPCIGIARLKRWRRAHMLGLNPPIEVLAVLL
KPDDTTKQRAYIDELMS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcctccctctcgtcgccgcggtggcaatactgccgccacccgttcaaaccaggcgacc
ttatcgttcggctccaagtccagagtcacgaagccatcagcagcgccatctacacgctct
cagaaagccaaagatctcgacctgattgatactactcgatcgagtacaccatccgttgaa
gatgtgtccgaagcagaacaggcctctgttactcccacggagccttcgcaaccccatgtg
gcagagcttgccgtaaggaagcaggctcagacagagattcaacaaccacgatcagaagag
gatgctaaggcggaaaagattaccgaaaggcagctgcagcagtactggaagaaggaagaa
gcaaagagacaagggcccagagttcaccaggagggcctcgagctacgagagaagattctg
cgcaacttcgacctctcaagccagtacgggccttgcattggaattgctcgactgaagcgg
tggagacgtgcgcatatgctgggcctcaatcctcccattgaggtgttggccgtgttgttg
aaaccggacgataccactaaacagagagcgtatattgacgagttgatgtcttga

DBGET integrated database retrieval system