KEGG   Aspergillus niger: ANI_1_112094Help
Entry
ANI_1_112094      CDS       T01030                                 

Gene name
An11g00720
Definition
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  
DNA polymerase delta subunit 4
Organism
ang  Aspergillus niger
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ANI_1_112094 (An11g00720)
   00240 Pyrimidine metabolism
    ANI_1_112094 (An11g00720)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ANI_1_112094 (An11g00720)
   03410 Base excision repair
    ANI_1_112094 (An11g00720)
   03420 Nucleotide excision repair
    ANI_1_112094 (An11g00720)
   03430 Mismatch repair
    ANI_1_112094 (An11g00720)
   03440 Homologous recombination
    ANI_1_112094 (An11g00720)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ANI_1_112094 (An11g00720)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 197 aa AA seqDB search
MPPSRRRGGNTAATRSNQATLSFGSKSRVTKPSAAPSTRSQKAKDLDLIDTTRSSTPSVE
DVSEAEQASVTPTEPSQPHVAELAVRKQAQTEIQQPRSEEDAKAEKITERQLQQYWKKEE
AKRQGPRVHQEGLELREKILRNFDLSSQYGPCIGIARLKRWRRAHMLGLNPPIEVLAVLL
KPDDTTKQRAYIDELMS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcctccctctcgtcgccgcggtggcaatactgccgccacccgttcaaaccaggcgacc
ttatcgttcggctccaagtccagagtcacgaagccatcagcagcgccatctacacgctct
cagaaagccaaagatctcgacctgattgatactactcgatcgagtacaccatccgttgaa
gatgtgtccgaagcagaacaggcctctgttactcccacggagccttcgcaaccccatgtg
gcagagcttgccgtaaggaagcaggctcagacagagattcaacaaccacgatcagaagag
gatgctaaggcggaaaagattaccgaaaggcagctgcagcagtactggaagaaggaagaa
gcaaagagacaagggcccagagttcaccaggagggcctcgagctacgagagaagattctg
cgcaacttcgacctctcaagccagtacgggccttgcattggaattgctcgactgaagcgg
tggagacgtgcgcatatgctgggcctcaatcctcccattgaggtgttggccgtgttgttg
aaaccggacgataccactaaacagagagcgtatattgacgagttgatgtcttga

DBGET integrated database retrieval system