KEGG   Aspergillus niger: ANI_1_1130014Help
Entry
ANI_1_1130014     CDS       T01030                                 

Gene name
An01g08470
Definition
ubiquitin carboxyl-terminal hydrolase creB
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ANI_1_1130014 (An01g08470)
Peptidases [BR:ang01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ANI_1_1130014 (An01g08470)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 758 aa AA seqDB search
MGSFLRSFRRDVGSSTPSVGATPAKKEPLALPITPLEKMLQEMGSDSVRQDGSDKFFGME
NYGNTCYCNSILQCLYYSVPFREAVLNYPTRTPIESLEAALAKNLRYQNFAANQEAEAQA
EKQRLANAQRPGAPPAQPPKPEDKDSSEYKKKIALQSLPLLETKNNAGSYGMSESLFTSL
KDIFESVVASQSRIGIVRPQHFLDVLRRENEMFRSAMHQDAHEFLNLVLNEVVANVEAEA
MKQPIPSLPPADTTDSSRQSISSGSKTPNTTRWVHELFEGTLTSETQCLTCENVSQRDEI
FLDLSVDLEQHSSVTSCLRKFSAEEMLCERNKFHCDNCGGLQEAEKRMKIKRLPRILALH
LKRFKYTEDLQRLQKLFHRVVYPYHLRLFNTTDDAEDPDRLYELYAVVVHIGGGPYHGHY
VSIIKTQDRGWLLFDDEMVEPVDKNYVRNFFGDKPGLACAYVLFYQETTLEAVLKEQEME
NMNASAADANEAAVKPNGFPQPAGLAHVHSASQIPVQDEPQRHTGLRRAPTAPQLPTHTE
YPGPDIEPSSPAVATPPPVPPIPETANRPLSPKKSDIQSKKERAKEEKERKAAEKEMEKQ
RRKEQEARVKENQRREEAELKAALEASKASKADEDRRNPTENGKDGDPKRSSNGLSRLKR
GSKSFSQRLGKDKESRASSSGLPSVPSAEPLTPNPVPLEPVQQLSPRKASPPKESHVVHK
PLGQDDEPDALKSPKGDRAGHGKWRSFSIRKKSFSILS
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggggtcttttctgaggagtttccgaagagatgtgggatcttccactccttcggtcggg
gcgactcccgcgaagaaagaacccctggcgcttccgattaccccgctggagaagatgctg
caggaaatgggttcggattcggttcgacaagacggtagtgacaagtttttcggcatggag
aactacggaaatacttgttactgtaactcaatcttgcagtgtctctactattcagttccc
tttcgcgaagccgtactcaactatccgacacgaacgccgatagaaagcctagaagctgcg
ttggcgaaaaaccttcgctaccagaacttcgccgcgaatcaggaagctgaggcacaagcg
gagaaacagagactcgccaacgctcagcgacccggcgcacctcccgctcagccaccgaaa
cccgaagacaaggactcctcggagtacaaaaagaaaatcgctctgcagtcgctgccgttg
ttagaaacgaagaataatgccggcagttatgggatgtcagagtcgctcttcacatctctc
aaagatatcttcgaatctgtcgttgcgagccagtccaggataggtatcgtacgaccgcag
catttcctggacgttcttcgccgtgagaatgagatgttccggtcggccatgcatcaagat
gctcacgaatttctgaaccttgtgcttaacgaagtagttgccaatgtagaagcagaagcc
atgaagcaacctataccgagcttgccgccagcagacaccaccgattcctccaggcagtcg
atcagttcgggctctaaaactcccaacacaactcgatgggtgcacgagctgttcgaggga
accttgacatcagagacacagtgcttgacgtgtgagaatgtttcccagcgtgacgagatt
tttctggatttgtcggtagatctggagcagcattcatcagtcacttcgtgcctaaggaaa
ttctcagcagaagagatgctctgcgagcgaaacaagtttcactgcgataactgcggtggg
ctccaggaggctgagaaacgcatgaaaatcaagcgcctcccgcgaattttggcactgcac
ctcaagcgatttaaatataccgaggatcttcagcgactgcaaaagctctttcatcgggtt
gtgtacccttaccatcttcgcctctttaatacaacagacgatgcggaggatcctgatcgc
ctatacgagttatacgctgtggtggttcacattgggggcggtccttaccatgggcattat
gtgtctattatcaagacgcaggatcgtggatggctgctctttgatgacgaaatggtggag
cctgttgacaagaattacgtgcgcaacttctttggtgataagcccggcttagcatgtgcc
tacgtcctattctaccaggagaccacgttagaggctgtcttgaaggagcaagaaatggag
aacatgaatgccagtgcggctgatgcgaacgaagctgctgtgaaaccgaacggcttcccc
caacccgcgggattggctcatgttcatagtgcctcgcagatccccgtgcaagacgagcct
caacgacacacgggcctccgacgagcccccaccgcacctcagctacccacacataccgag
tatcctggtccggacattgagccgtcaagtcccgcggtagcaactccacccccagtcccg
ccaatacctgaaactgccaaccggcctttgagcccaaagaagagtgacatccaatccaag
aaggagcgggccaaagaagaaaaagagcgcaaagcggctgaaaaggagatggagaagcag
cgtcggaaagaacaagaagcgagggttaaggaaaatcagcgacgcgaggaagccgaacta
aaggctgccctggaggccagcaaagcgtcgaaagcagatgaggatcgacgcaatcctacg
gagaacggaaaggacggcgatccgaagaggtccagcaacggtcttagccggttgaaacga
ggcagcaagagcttcagtcagcgcttaggcaaagacaaagaaagccgtgcttcgtcatct
ggtctgccgtcggttcctagtgccgaacctttaacgccgaatccagtgccattggagccc
gtccagcagctctcaccgcggaaggcttccccgccaaaggaatcacacgtcgttcataag
cccttaggtcaagacgacgagccagacgctcttaagagtcccaagggcgatcgggcaggg
catgggaaatggcgcagtttcagcatccggaagaaatcgttcagcatcctttcttaa

DBGET integrated database retrieval system