KEGG   Aspergillus niger: ANI_1_1134144Help
Entry
ANI_1_1134144     CDS       T01030                                 

Gene name
An16g08490
Definition
dolichyl-phosphate-mannose--protein mannosyltransferase 4
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ang  Aspergillus niger
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    ANI_1_1134144 (An16g08490)
Enzymes [BR:ang01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     ANI_1_1134144 (An16g08490)
Glycosyltransferases [BR:ang01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   ANI_1_1134144 (An16g08490)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 775 aa AA seqDB search
MSSSPSPSLRKRGGKKESTPVPADNFSSPLSKASAPRSEWDYWLAISILTVLAFVTRFYK
ISYPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFMGWLVGYDGHFLFDNIGDS
YIEHQVPYVALRAMPATLGALTVPVVFLIMWESGYSLPACVLSAGLVLFDNAHIGEDRLI
LLDASLVLTMALSILCYIRFYKLRHEAFGRKWWKWLLLTGVSLSCVISTKYVGVFTFVTI
GSAVMVDLWNLLDIRRRGGALTMFQWGQHFVARAFALIIVPFFFYLFWFQVHFAILTRSG
PGDDFMTPEFQETLSDNVLSAQSIGIEYYDTITMKHKDTKVYLHSHLERYPLRYDDGRIS
SQGQQVTGYPYNDTNNQWQIIPTVPLDVTDTSGHKVRNGDVVQLRHMGTDTILLTHDVAS
PYYPTNQEFTTVSHEVANGDRHNDTLFEIKIENGKPHQEFRTLSSHFKLIHMPTRVAMWT
HTTPLPDWAFKQAEINGNKNILQTSNLWFVESIESLEEDSPRLVKEERQVKHLPFFRKYL
ELQRAMFFHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPVGWWIASSL
LAVFAGVIGADQLSLRRGVDAVEEIWGQGSRSRLYNSMGFLFLCWAAHYFPFWLMGRQRF
LHHYLPAHLASALVAGALIEFIFNLEPLSVIQRVRSEDDPSGKAKASASVGRFVTAKERM
GTKSLLAGWIATLVILAGTIYGFVFYAPLTYGTPGLDVPGILARKWLGYDLHFAK
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatctccttcgccctctctccgcaagaggggcggcaagaaggagagtactccc
gtgcctgcggataatttctcttctcctttgtccaaagcgagtgctcctcgttcggaatgg
gattactggctggccatttccatcctgaccgtgcttgcattcgtcacccgtttctacaag
atttcctaccccaacgaggtcgtctttgatgaggtgcactttggaaagtttgcctcgtac
tacctccagcgcacgtacttcttcgatgtccaccctccatttggcaagctccttttcgcc
ttcatgggctggctggtcggctatgatggccacttcctcttcgataacattggtgattcc
tacattgaacaccaggtcccctacgtggctcttcgggctatgccggccacgctcggtgcc
ctgacggttcccgtcgtgttcctgatcatgtgggaatccggatactcgctgcccgcttgt
gttttgtccgctggtcttgtgctgttcgacaatgcccatatcggagaggaccgtctgatc
cttctggatgcctcgttggtcctgaccatggccctgagcatcctatgctatatccgcttc
tacaagctgcgccacgaggcatttggacggaaatggtggaagtggctgctcctgaccggt
gtgtcactcagctgtgtcatctccaccaagtacgtcggtgtcttcacttttgtcaccatc
ggttcggccgtcatggttgatctgtggaatctcttggatatccggcgccgtggcggtgct
ctcaccatgttccagtggggtcagcacttcgttgctcgtgcctttgctctgatcattgtg
cccttctttttctatctgttctggttccaagtccactttgccatcctcacccgctccggt
cccggcgatgatttcatgacccccgagttccaggaaactctcagcgataatgtgctgagc
gcgcagtctatcggtattgaatactacgacaccattaccatgaagcacaaggataccaag
gtctacctccacagtcatcttgagaggtatccccttcggtacgatgatggacgtatctcc
agtcagggccagcaggtcaccggatacccttataacgacacgaacaaccaatggcagatc
atcccaacggtgcctttggatgtgactgataccagcggacacaaggtgcgcaacggtgat
gttgttcagctccgccatatgggcacagacaccattctgctcacccacgatgttgcatct
ccctactacccgaccaaccaggagttcaccactgtttcccatgaggttgccaacggtgac
cgtcacaatgacacactgttcgagattaagatcgagaacggcaagccccatcaggaattc
cgcactttgtccagccacttcaagctgatccatatgcccacgcgtgtggccatgtggact
cacaccacgccgctgcccgactgggccttcaagcaagccgagatcaacggcaacaagaat
atcctccagaccagcaacttgtggttcgttgaatcgattgagtccttggaagaggacagt
ccccgtctggtcaaggaagagcgccaggtcaagcacctgccctttttccgcaagtacctt
gaactgcagcgcgccatgttcttccacaacaatgccctgaccagcagccacccgtacgcg
agtgagcccttccagtggcctttcctgctccgcggtgtcagcttctggaccaagaacgac
acccgggagcagatctatttccttggtaacccggtcggatggtggatcgctagtagtctg
ttggcggtgtttgccggtgtcatcggtgctgaccagctgtctctgcgtcgcggtgtcgat
gccgtggaagagatctggggccaaggctcccgttcccgcctgtacaacagcatgggattc
ttgttcctgtgctgggctgcccactacttccctttctggctgatgggccgtcagcgtttc
ttgcaccactacctccccgctcatcttgcttcggctcttgtggctggtgccttgatcgag
ttcattttcaacctggagccgctctcggtcattcagcgcgtccggtccgaagacgacccc
tcgggcaaggccaaggcgtcagcttcggttggacgcttcgttacggccaaggaacgtatg
ggcaccaagtcccttcttgcgggctggatcgcgaccctggtcatcctggccggtacgatc
tacggattcgtcttctatgccccgttgacgtacggcaccccgggtctggatgtgccgggc
atccttgcccgcaagtggctgggctacgacctgcactttgccaaatag

DBGET integrated database retrieval system