KEGG   Aspergillus niger: ANI_1_114164Help
Entry
ANI_1_114164      CDS       T01030                                 

Gene name
An18g01020
Definition
gentisate 1,2-dioxygenase
Orthology
K00450  
gentisate 1,2-dioxygenase [EC:1.13.11.4]
Organism
ang  Aspergillus niger
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ang00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 331 aa AA seqDB search
MSPSACNTGSNGADSAEQLLQDLKKSNTLPLWTQMTRLNPPEPNPTAVPFIWRYDSIRPN
LLRAGELVTEKQAERRVLMLVNPARDAPYTTDTLYAGLQLVMPNETAPAHRHTAFAMRYI
IEGNGGFTAVHGKRIKMQKGDVILTPTWNYHDHGKDGTGPMIWLDGLDLPNFRHFPVHFV
DHYDQPRYPAEDVDSATSPIVFPWDKMKAELDKAPGTWAVRRYLRADGSEVSRVLGGSAE
RVDAGTSSLPRQETTSAVYHVIAGSGCSEIGDKTLVWETGDTFCVPSWYKYRHIAAEGET
VYLYRFDDKPMISALGFYRSIDTDLATLVSQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatcagcttgcaataccgggtcgaacggcgcagacagcgcagagcagcttcta
caagacttgaagaagagcaatactctgccactatggacgcagatgaccagactcaacccg
ccagagcctaatccaacagctgtacccttcatttggagatatgatagcatccgtccaaac
ttgcttcgcgccggcgaactcgtcaccgagaaacaggctgagagaagagtgctcatgctc
gtcaaccccgctagagatgcgccatacacaaccgatacgctctacgcaggtctccaactc
gtaatgcccaatgagacagcccccgcccaccgtcataccgcgttcgcaatgcggtatatt
atcgaaggcaatggggggtttactgctgtgcatggcaagaggatcaagatgcagaaaggc
gacgtgattctcaccccgacgtggaactaccatgaccacgggaaggacggaaccgggcct
atgatctggctggacggtctggatctacctaatttccgccacttccctgtgcattttgtc
gatcactatgatcagccgcggtacccggcggaggatgttgatagcgcgacctcgcccatt
gtattcccgtgggacaagatgaaggcggagctggataaggccccgggtacctgggctgtg
agacgatatcttagggctgatggtagcgaagtgagtcgtgttctaggcggtagtgccgaa
cgggtcgacgctggtacctcttccctaccccggcaagagacaacctccgcggtctaccat
gttattgcgggaagcggatgctcggaaatcggggacaagactcttgtatgggagacaggg
gatacattctgcgtgccgtcctggtacaagtatcggcatattgcggctgagggggagacc
gtgtacctttaccgcttcgacgataagcctatgatctcggccctggggttctaccgctcc
atcgatacggatctggcgacgctggtgtcccagtag

DBGET integrated database retrieval system