KEGG   Aspergillus niger: ANI_1_114164Help
Entry
ANI_1_114164      CDS       T01030                                 

Gene name
An18g01020
Definition
gentisate 1,2-dioxygenase
Orthology
K00450  
gentisate 1,2-dioxygenase [EC:1.13.11.4]
Organism
ang  Aspergillus niger
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    ANI_1_114164 (An18g01020)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.4  gentisate 1,2-dioxygenase
     ANI_1_114164 (An18g01020)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 331 aa AA seqDB search
MSPSACNTGSNGADSAEQLLQDLKKSNTLPLWTQMTRLNPPEPNPTAVPFIWRYDSIRPN
LLRAGELVTEKQAERRVLMLVNPARDAPYTTDTLYAGLQLVMPNETAPAHRHTAFAMRYI
IEGNGGFTAVHGKRIKMQKGDVILTPTWNYHDHGKDGTGPMIWLDGLDLPNFRHFPVHFV
DHYDQPRYPAEDVDSATSPIVFPWDKMKAELDKAPGTWAVRRYLRADGSEVSRVLGGSAE
RVDAGTSSLPRQETTSAVYHVIAGSGCSEIGDKTLVWETGDTFCVPSWYKYRHIAAEGET
VYLYRFDDKPMISALGFYRSIDTDLATLVSQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatcagcttgcaataccgggtcgaacggcgcagacagcgcagagcagcttcta
caagacttgaagaagagcaatactctgccactatggacgcagatgaccagactcaacccg
ccagagcctaatccaacagctgtacccttcatttggagatatgatagcatccgtccaaac
ttgcttcgcgccggcgaactcgtcaccgagaaacaggctgagagaagagtgctcatgctc
gtcaaccccgctagagatgcgccatacacaaccgatacgctctacgcaggtctccaactc
gtaatgcccaatgagacagcccccgcccaccgtcataccgcgttcgcaatgcggtatatt
atcgaaggcaatggggggtttactgctgtgcatggcaagaggatcaagatgcagaaaggc
gacgtgattctcaccccgacgtggaactaccatgaccacgggaaggacggaaccgggcct
atgatctggctggacggtctggatctacctaatttccgccacttccctgtgcattttgtc
gatcactatgatcagccgcggtacccggcggaggatgttgatagcgcgacctcgcccatt
gtattcccgtgggacaagatgaaggcggagctggataaggccccgggtacctgggctgtg
agacgatatcttagggctgatggtagcgaagtgagtcgtgttctaggcggtagtgccgaa
cgggtcgacgctggtacctcttccctaccccggcaagagacaacctccgcggtctaccat
gttattgcgggaagcggatgctcggaaatcggggacaagactcttgtatgggagacaggg
gatacattctgcgtgccgtcctggtacaagtatcggcatattgcggctgagggggagacc
gtgtacctttaccgcttcgacgataagcctatgatctcggccctggggttctaccgctcc
atcgatacggatctggcgacgctggtgtcccagtag

DBGET integrated database retrieval system