KEGG   Aspergillus niger: ANI_1_1150034Help
Entry
ANI_1_1150034     CDS       T01030                                 

Gene name
An03g02330
Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
ang  Aspergillus niger
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ang00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:ang00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 306 aa AA seqDB search
MYNLSDAQYGKDNVRLYKVHRDAGTGVQTVYELTVCVLLEGDIETSYTKEDNSVLVTTDA
IKNTCYIVAKHNPVHPPELFGSILGKHFITQYKHIHTAHIDITCHTWERMTIENEPHPHS
FYQDGSVKRQIRVDVSKASGINITSAIFGLSVLKSTRSEFWGYIKDEYTTLPETWDRILS
SDVDIKWRWKHFGDVSDVEANVSHFIEAFASARNASFKAFAEDNSMSAQATLYKMAEKFL
DCVPLADAVEYSWPNKHYVEIDLSWHKGIRNTDKDAEVYLPQSAPNGLIKGTLTRSTLDR
SRSAKL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacctatccgatgcacaatatgggaaagacaacgttcgactatacaaagtccac
cgtgatgcaggaacgggtgtgcaaacagtatacgaactgacagtctgcgtcttgctggaa
ggagacatagaaacttcttacaccaaagaagacaacagcgtccttgtcactaccgatgca
atcaagaacacatgctacatcgttgccaaacataaccccgtccaccctccggaactgttc
ggctccattctgggcaaacacttcatcactcaatacaagcacatccacacagcccacatc
gacataacctgccatacctgggaacgaatgaccatcgagaacgagccacatccgcattca
ttttatcaagatgggagtgtcaaacggcagatccgcgtggatgtttccaaagcttcaggc
atcaatatcacgtcagctatttttggcctcagtgtactgaagagcaccaggtctgagttc
tggggttacatcaaagacgaatacacgacgttgcctgagacatgggaccgcattctgagc
agtgatgtggatatcaagtggagatggaagcatttcggagatgtctcggatgttgaagcg
aatgtgtcgcattttattgaggcctttgcgagtgctagaaatgcatccttcaaggcgttt
gcggaagataatagtatgagtgcgcaggcgactctgtacaagatggccgaaaagtttctg
gactgtgttcctttggctgatgctgtggagtactcttggcctaataagcactatgtggag
atagacctgagctggcacaaggggattcggaacaccgacaaagatgcagaggtgtatttg
ccacaatcggcgccaaatggccttatcaaggggactttgacccgttctactctcgatagg
agcagatctgctaagctttga

DBGET integrated database retrieval system