KEGG   Aspergillus niger: ANI_1_1156134Help
Entry
ANI_1_1156134     CDS       T01030                                 

Gene name
An15g00990
Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ang  Aspergillus niger
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ANI_1_1156134 (An15g00990)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     ANI_1_1156134 (An15g00990)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     ANI_1_1156134 (An15g00990)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 178 aa AA seqDB search
MKAYWYDNKPGDQREPHDDGRPVDEAYLASLGVFYKYCPSIEDVDALAAERGYKNRDEVT
VSPKTMGDVYEEKVKMFFHEHLHEDEEIRYIRDGEGYFDVRGKEDEWVRIKLVKDDLIIL
PAGIYHRFTTDEKNYVKAMRLFQEEPKWTPLNRSNELDENPHRVSYLGSLGKAAVAAV
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttactggtacgataacaagccgggcgaccagcgcgaaccccacgacgacggt
cgtcccgtcgacgaagcttacctcgcctctctgggtgtcttctacaagtactgcccgagc
atcgaggacgtcgacgccctggccgccgagcgcggatacaagaaccgcgatgaggtcacc
gtgtcccccaagaccatgggcgatgtgtacgaggagaaggtgaagatgttcttccacgaa
catctccacgaggacgaggaaatccgctacatccgggatggtgagggatactttgatgtc
cgtggcaaggaggacgagtgggtccgcattaagttggtgaaggatgatctgattattctc
cccgcgggtatctaccatcgctttacgacggatgagaagaactatgtcaaggctatgcgt
ctcttccaggaggaacccaagtggactcccttgaaccgtagcaacgaactggatgagaac
ccgcaccgtgtgtcttacctcggtagtctgggtaaggctgctgttgctgctgtttaa

DBGET integrated database retrieval system