KEGG   Aspergillus niger: ANI_1_116094Help
Entry
ANI_1_116094      CDS       T01030                                 

Definition
DNA polymerase delta subunit 4
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ang  Aspergillus niger
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ANI_1_116094
   00240 Pyrimidine metabolism
    ANI_1_116094
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ANI_1_116094
   03410 Base excision repair
    ANI_1_116094
   03420 Nucleotide excision repair
    ANI_1_116094
   03430 Mismatch repair
    ANI_1_116094
   03440 Homologous recombination
    ANI_1_116094
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      ANI_1_116094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 197 aa AA seqDB search
MPPSRRRGGNTAATRSNQATLSFGSKSRVTKPSAAPSTRSQKAKDLDLIDTTRSSTPSVE
DVSEAEQASVTPTEPSQPHVAELAVRKQAQTEIQQPRSEEDAKAEKITERQLQQYWKKEE
AKRQGPRVHQEGLELREKILRNFDLSSQYGPCIGIARLKRWRRAHMLGLNPPIEVLAVLL
KPDDTTKQRAYIDELMS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcctccctctcgtcgccgcggtggcaatactgccgccacccgttcaaaccaggcgacc
ttatcgttcggctccaagtccagagtcacgaagccatcagcagcgccatctacacgctct
cagaaagccaaagatctcgacctgattgatactactcgatcgagtacaccatccgttgaa
gatgtgtccgaagcagaacaggcctctgttactcccacggagccttcgcaaccccatgtg
gcagagcttgccgtaaggaagcaggctcagacagagattcaacaaccacgatcagaagag
gatgctaaggcggaaaagattaccgaaaggcagctgcagcagtactggaagaaggaagaa
gcaaagagacaagggcccagagttcaccaggagggcctcgagctacgagagaagattctg
cgcaacttcgacctctcaagccagtacgggccttgcattggaattgctcgactgaagcgg
tggagacgtgcgcatatgctgggcctcaatcctcccattgaggtgttggccgtgttgttg
aaaccggacgataccactaaacagagagcgtatattgacgagttgatgtcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system