KEGG   Aspergillus niger: ANI_1_120104Help
Entry
ANI_1_120104      CDS       T01030                                 

Gene name
An12g00820
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ang  Aspergillus niger
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ANI_1_120104 (An12g00820)
   00052 Galactose metabolism
    ANI_1_120104 (An12g00820)
   00500 Starch and sucrose metabolism
    ANI_1_120104 (An12g00820)
   00520 Amino sugar and nucleotide sugar metabolism
    ANI_1_120104 (An12g00820)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ANI_1_120104 (An12g00820)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 521 aa AA seqDB search
MASKALPSHLRAPASDSASAASFGKHHGKSQSHMAFENASTSVAASQMRNALNALAETVP
DAAERKRFEAEMDNFFALFRRFLNDKAKGNEVNWDRIAPPQPSQVVNYNDLGSEASVEFL
NKLAVVKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEHLNRTFNVNVPFVLMNSF
NTDQDTQSIIKKYQGHNVDIITFNQSRYPRIIKDSLLPAPKSFDAPLQDWYPPGHGDVFE
SLYNSGTLDKLLERGVEYIFLSNADNLGAVVDLRILQHMVDTQAEYIMELTDKTKADVKG
GTIIDYEGKARLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMSLRAIKRVVEENELEMEI
IANEKSIPADKKGEADQAIYQLETAVGAAIRHFKNGHGVNVPRRRFLPVKTCSDLMLVKS
DLYRLEHGQLVMDPNRFGGVPVIKLGSDFKKVSDFQKHIPSIPRIVELDHLTITGAVNLG
RNVQLKGTVIIVATEGSTIDIPPGSVLENCVVQGSLRILEH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaggctttgcccagtcacctcagagctcccgcgagcgactccgcgagtgct
gcctccttcggcaagcaccacggaaagtcccagtctcacatggcctttgagaatgcctct
actagcgtggctgcctctcagatgcgcaatgccctgaacgccctcgccgagaccgttccc
gatgccgccgagcgcaagcgcttcgaggctgagatggataacttcttcgccctcttccgc
agattcctcaacgacaaggccaagggcaacgaggtcaactgggaccgcatcgcccctccc
cagccctctcaggtcgtcaactacaatgatctgggcagcgaggcctccgttgagttcctg
aacaagctggctgtcgtcaagctcaacggtggtctgggtacctccatgggctgtgtcgga
cccaagtccgtcattgaggtccgtgagggcatgtccttcttggatctgtccgtccgccag
attgagcacctcaaccgcaccttcaacgtcaacgtgcccttcgtcctgatgaactctttc
aacaccgaccaggacacccagtcgatcatcaagaagtaccagggccacaacgtcgacatc
atcaccttcaaccagtcccgttacccccgtatcatcaaggactctcttcttcccgccccc
aagtccttcgacgctcccctgcaggactggtaccctcccggtcacggtgacgttttcgag
tctctgtacaactctggtaccctggacaagctcctggagcgtggtgtcgagtacatcttc
ctgtccaacgccgacaacctgggtgctgtcgtcgatctccgcattctccagcacatggtt
gacacccaggctgagtacatcatggagttgaccgacaagaccaaggctgacgtcaagggt
ggtaccatcattgactacgagggcaaggcccgtctgcttgaaattgctcaggtgcccaag
gagcacgtcaacgagttcaagtccatcaagaagttcaagtacttcaacaccaacaacatc
tggatgagcctccgtgccatcaagcgtgtggtggaggagaacgagctggagatggagatc
atcgccaacgagaagtccatccctgctgacaagaagggtgaggccgaccaggccatctac
cagctggagaccgccgttggtgctgccattcgccacttcaagaacggacatggtgtcaac
gttcctcgtcgccgcttcctgcccgtcaagacctgctccgacctgatgctggtcaagtct
gatctgtaccgcctggagcacggtcagcttgtcatggaccccaaccgcttcggtggtgtc
cccgtcatcaagctcggttccgacttcaagaaggtctctgacttccagaagcacatcccc
agcatccctcgcatcgttgagctggaccacctcaccatcaccggtgccgtcaacctgggc
cgcaacgtgcagctcaagggcactgtcatcattgttgccacggaaggcagcaccattgac
atccctccgggttccgtgcttgagaactgcgttgtgcagggatccctgcgcattctggaa
cactag

  All links  
No link information was found.   
DBGET integrated database retrieval system