KEGG   Aspergillus niger: ANI_1_1256014Help
Entry
ANI_1_1256014     CDS       T01030                                 

Gene name
An01g09270
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ang  Aspergillus niger
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANI_1_1256014 (An01g09270)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ANI_1_1256014 (An01g09270)
Enzymes [BR:ang01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ANI_1_1256014 (An01g09270)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 538 aa AA seqDB search
MASFEEEDRKYLDDVQAVQKWWQDSRWRHTKRPFTAEQIVAKRGTLKIEYPSNAMSKKLW
KILESNFEKKVPSFTYGCLEPTMLTQMAKYLDTVYVSGWQSSSTASSTDEPSPDLADYPM
NTVPNKVNQLFLAQLFHDRKQREERITTPKEQRGKVANVDYLRPIIADADTGHGGLTAVM
KLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLLA
IARTDSEAATLITSTIDYRDHAFVVGSTNPNLQPLNDLMVAAEQAGKNGNELQAIEDQWV
AQAGLKLFSEAVIDTINKSSSGNKKALIDEYLKKAKGKSNREARAIAKDITGVDIYWDWD
APRTREGFYRYQGGTQCAVNRAIAYGPFADLIWMESKLPDYAQAKEFADGVHAVWPEQKL
AYNLSPSFNWKKAMPRDEQETYIQRLGALGYCWQFITLAGLHTTALITDQFAKAYAKQGM
RAYGELVQEPEMEQGVDVVTHQKWSGANYVDNMLKMVTGGISSTAAMGKGVTEDQFKH
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctttgaagaagaagaccggaagtatctggacgatgtccaggccgtccagaag
tggtggcaggactccagatggagacacaccaagcgcccctttactgctgagcagattgtg
gctaagcgcggcaccctgaagatcgaatacccttccaatgctatgagcaagaagctgtgg
aagatcttggagagcaatttcgagaaaaaagtacctagcttcacctatggctgtctcgag
cccacaatgctcacccagatggccaaataccttgacaccgtctacgtctctggctggcag
agctcctccaccgcctcgtccaccgacgaaccctctcccgaccttgccgactaccccatg
aataccgtccccaacaaggtcaaccagctgttcctggctcagctgttccatgaccggaaa
cagcgcgaagaacgcatcaccactcccaaggagcagcgtggcaaggtggcaaatgttgac
tacctccgccccatcattgcggatgccgataccggacatggtggcttgacggccgtgatg
aagctgaccaagctgtttattgagcgtggtgctgctggtattcacattgaagaccaggct
ccgggaaccaagaagtgcggccacatggccggaaaggtgcttgtgcctatcagcgaacac
atcaaccgtctggtggctatccgtgcgcaagcggatatcatgggcaccgatctgcttgcc
atcgctcgaaccgactccgaagccgccactctcattacctccacaattgattaccgcgat
catgccttcgtcgtgggctcaacaaaccccaacctgcagcccctcaacgacctcatggtg
gccgcagagcaggctggcaagaacggaaacgagctgcaagccatcgaagaccagtgggtt
gctcaggctggcctgaagcttttcagcgaggctgtcatcgataccatcaacaagagctcc
tctggtaacaagaaggccctcatcgatgagtacctgaagaaggccaaggggaagagcaac
cgcgaagcccgggctattgccaaggacatcactggcgtcgacatctactgggactgggac
gcccctcgcacccgggagggcttctaccggtaccagggaggtacgcagtgtgcggtgaac
cgcgccattgcgtatggcccattcgcagatctcatctggatggagagcaagctgcccgac
tatgcccaggcgaaggagtttgccgacggtgttcacgccgtgtggcccgagcagaagctg
gcgtacaacctgtcgccctcattcaactggaagaaggcgatgccgcgcgatgagcaggag
acctacatccagcgcctgggagccctgggatactgctggcagttcatcaccctggcgggt
ctgcacacgacggcgctgatcacggatcagtttgccaaggcgtacgcgaagcagggcatg
cgggcgtacggcgagttggtgcaagaacccgagatggagcagggggtggatgtggtgact
caccagaaatggagtggtgccaactacgtggataatatgttgaagatggtgacgggcggc
atcagcagtacggccgccatgggcaagggcgtcacggaggatcagttcaagcactga

DBGET integrated database retrieval system