KEGG   Aspergillus niger: ANI_1_1278094Help
Entry
ANI_1_1278094     CDS       T01030                                 

Gene name
An11g09890
Definition
protein mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ang  Aspergillus niger
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    ANI_1_1278094 (An11g09890)
Enzymes [BR:ang01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     ANI_1_1278094 (An11g09890)
Glycosyltransferases [BR:ang01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   ANI_1_1278094 (An11g09890)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 944 aa AA seqDB search
MATKSKDTLAVTPPPKSSSRSPSRSPGPKSRKKAAAASSSYASDGVTDNNIFYLPSSDYK
TLALVTIVAAVVRLFRIYQPSSVVFDEVHFGGFATKYIKGRFFMDVHPPLAKLLITLAGW
LAGFDGEFDFKDIGKDYLEPGVPYVAMRMLPAILGVLTIPLMFLTLRASGCRTITAVLGA
GVVIFENGLITQSRLILLDSPLVFFTALTALSFTCFTNQQELGPSHSFRGPWWFWLVATG
LSLGATLSVKWVGLFTVAWVGSLTVLQLWVLLGDPKNVTPRLWFKHFFARVFCLIVIPLS
FYCAMFGIHFLCLVNPGDGDGFMSSEFQATLNSKGMQDVPADVAFGSRVSIRHLNTQGGY
LHSHNHMYPTGSKQQQITLYPHKDENNIFVLENQTQPLGPYGTVEGPLAWDNITAEYIED
GAVIRLNHLITRRRIHSHDERPPVTDVDWQFEVSAYGYDGFPGDANDLFRVEIVKSLSEG
EEAKKRLRTIQTKFRLVHIMTNCVLFSHKVKLPEWGFDQQEVTCARGATLPNSIWYIESN
SHPMLADDVEKVNYKNPGFFGKFWELQKVMWITNAGLTESHAWDSRPPSWPTLLRGINFW
GKDHRQVYLLGNPFIWWSSTAAIVIYIIFKGVSVLRWQRSCGDYHNVNFKRFDYEIGTSV
LGWAFHYFPFYLMARQLFLHHYFPALYFAIIALCQEFDFLANRIKSLGIPSRPVIGKVLA
GIFLAISIFTFTLYSPLVYGNPWTQDACNSVKLMDSWDFDCHTFYTSLDQYVTQIVDTHA
AIPTTQASVQQAPPVVMEQPPQQQVPQQVQQQNQEVLQEEAQEPGVTPRARHTAKARVEY
RDQHGNVLDEELVAQLKKEGKVQFESRHETKTRLENGRIVDMIDGQIAPPHPDVEGQNPE
TVGRQPPQAVEDGPASVAGQGSSQEQRGSPDPKPASEANEATKS
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaaatccaaagataccttggcggttacgccgccgccaaaatcatcctcacgc
tctcccagccgctctccgggtcccaagagccgcaagaaggccgccgcggcctcctcgagc
tatgcatccgatggcgttacggacaacaatatcttctatcttccctcctccgactataaa
accctggctctggtaaccattgttgcggcggtggtccggttgttcaggatctaccagcct
tctagcgttgtcttcgacgaagtccacttcggaggttttgcgacaaagtacatcaagggc
cgcttcttcatggatgtccatcctcctcttgccaagttgctcatcacacttgctggctgg
ctggcgggctttgatggcgaattcgatttcaaggacattggaaaggattacctcgaaccg
ggcgtaccatatgttgccatgcgcatgcttccggcgattttgggtgttctcacgatccca
ttgatgtttctgacattgagggcatcgggatgccgcactattactgcggtgctaggtgcc
ggtgtcgtcatctttgagaacggtctcattactcagtctcgtttaattctcttggattcc
ccattggtgttcttcactgcgctcaccgcattgtctttcacgtgctttaccaaccaacag
gaattgggaccttctcattccttccgtggaccctggtggttctggctcgtggcaactggc
ctctctctgggcgctactctgagcgtcaaatgggttggactcttcaccgttgcttgggtt
gggtcgcttactgttctccaactgtgggtgctgcttggcgatccgaagaatgtcacaccg
cgcctgtggttcaagcacttctttgctcgtgtcttctgcctgattgttattcccctcagc
ttctactgcgccatgtttggaatccacttcctgtgccttgtcaaccccggcgatggagat
ggattcatgtcgtccgagttccaagcaaccctgaactctaaggggatgcaggacgttccc
gccgatgttgcatttggatctcgcgtcagcatccgtcacctcaacacccaaggaggctat
cttcattctcacaatcacatgtaccccacgggaagcaagcagcagcagataacgctctac
ccccacaaggatgagaacaacattttcgtccttgagaaccagactcagcctcttggtccc
tacggaacagtggagggccccttggcctgggacaacatcaccgcagagtatatcgaagac
ggagctgtgatcaggttgaatcaccttatcactcggagacgaattcactcgcatgatgag
cggcctcctgtcacagatgtggattggcaattcgaggtgtctgcctatggatacgacgga
ttcccgggagatgcaaatgatctcttccgtgttgaaattgtgaagtctctgtctgagggt
gaggaggcgaagaagcgactgcggactatccagaccaagttccgtctggtgcacatcatg
actaactgtgtcttgttttcccacaaagtcaagcttcccgagtggggtttcgaccagcaa
gaggtgacctgtgccagaggagctactttgcccaacagcatctggtacattgagtcgaac
agccaccctatgctcgcagacgatgttgaaaaggtcaactacaagaaccccggtttcttc
ggcaagttctgggagctgcagaaggtgatgtggattaccaacgcgggcctaactgaatcg
cacgcttgggactctcgcccgccttcctggccaaccctcctccgtggcatcaacttctgg
ggcaaggatcaccgccaagtctacctcctgggcaaccccttcatctggtggtcttcaacc
gcggccatcgttatctacattattttcaagggagtctctgttcttcgctggcagcggagc
tgtggtgactaccacaacgtgaacttcaagcggttcgactacgaaatcggtaccagcgta
cttggctgggctttccactacttccccttctacctcatggcgcgacagctcttcctgcac
cattatttccctgccctctatttcgctattatcgccctctgtcaggaattcgacttcctt
gccaaccgtattaagagccttgggataccatctcgccctgttatcggcaaagtgttggcc
ggtatcttccttgcgattagcatctttactttcacactgtactcgcctctggtctacggc
aacccctggacacaggacgcttgcaacagtgtaaagctcatggacagctgggactttgac
tgccacacattctacactagccttgaccagtatgtgacccaaattgtggacacgcacgcg
gccatccccacgactcaggcatcggtacaacaagcaccccccgttgtgatggaacaacca
ccgcagcagcaggtcccgcagcaggtccagcaacagaaccaggaagtcctgcaggaggag
gcccaggaaccgggtgtcacgccccgggctcggcacactgccaaggcccgtgtggaatac
cgtgatcaacacggaaacgtgctggacgaagaacttgttgctcagttgaagaaggaaggt
aaggtccagttcgagagccgtcatgagacgaagactcgcctggagaacggccgcattgtc
gacatgatcgacggtcaaatcgccccgcctcaccccgacgttgaaggtcagaaccctgaa
actgttggaagacagccacctcaggctgtggaggacggcccagcctcagtagccgggcaa
ggaagctcccaggagcagcgcggctcgcctgaccccaagccggccagtgaggccaatgag
gctaccaaatcttga

DBGET integrated database retrieval system