KEGG   Aspergillus niger: ANI_1_1286014Help
Entry
ANI_1_1286014     CDS       T01030                                 

Gene name
An01g09520
Definition
mitogen-activated protein kinase spm1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ang  Aspergillus niger
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ang00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    ANI_1_1286014 (An01g09520)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     ANI_1_1286014 (An01g09520)
Protein kinases [BR:ang01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   ANI_1_1286014 (An01g09520)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 421 aa AA seqDB search
MADLQGRKIFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNAHTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPNANPDALDLLDRMLAFDPT
SRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVEDVQEMRHMIYDEVVRFRALVRQ
QSQAQAAAQQQQIAQQTNVPIPDNQQGGWKTEEPKPQEALAAGGGHHNDLESSLQRGMDV
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccgacttgcagggtcgcaagatcttcaaggtcttcaaccaggactttatcgtcgat
gagcgctacaatgtcaccaaggagctgggccagggcgcatacggcattgtctgcgccgcg
acaaatgctcacactggtgagggtgtcgccatcaagaaggtcaccaacgtcttcagcaag
aagatcctagccaaacgcgccctgagagagatcaagctgctccagcacttcagaggtcac
cgtaacatcacttgcttgtatgacatggacattccccgcccggacaacttcaacgaaacg
tacctgtacgaggaattgatggaatgcgatttggccgctattattcgctccggacagccc
ctaaccgatgcccatttccaatccttcatttaccaaatcctctgcggtctcaaatacatc
cattcggccaacgttctgcaccgtgatttgaagcctggaaaccttctcgtcaatgcggac
tgcgagctgaagatttgcgatttcggtctggcccgtggtttctctatcgacccggaggag
aatgcaggatacatgacggaatatgtcgccacaagatggtaccgtgcgccggagatcatg
ctgagcttccagagctacacgaaagccatcgatgtttggtccgtgggttgcattttggcc
gagctgctaggtggtcggcccttcttcaagggccgtgactatgtcgaccagcttaaccag
atcctccactatctgggtactcctaacgaggagactctgagccgcattggctcacctcgt
gcccaggagtacgttcgcaacttgcccttcatgcctaagattcccttccagcgcctgttc
cccaatgccaatcccgatgccctcgatctgctcgatcgcatgcttgcattcgacccgaca
tcgcgtatctcggttgaggaggcccttgagcatccttacttgcacatctggcacgacgcc
tcggatgagcccacctgcccgacgaccttcgacttccacttcgaggtggtcgaggacgtg
caggagatgcgccacatgatttacgacgaggtagtgcgcttccgggctctggtccggcag
cagtcgcaggcgcaggccgccgcgcagcagcagcagattgcccagcagaccaatgtgccc
atccccgacaaccaacaaggtggatggaagacggaggaacctaagccccaggaagcgctc
gccgcaggcggtggccaccacaacgatctggaatcgtcgctgcagcggggcatggatgtg
cagtag

DBGET integrated database retrieval system