KEGG   Aspergillus niger: ANI_1_1390094Help
Entry
ANI_1_1390094     CDS       T01030                                 

Gene name
An11g10690
Definition
MAP kinase kinase Ste7
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ang  Aspergillus niger
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ang04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 533 aa AA seqDB search
MADQFKARTLKRKNVKGLALNAAPKPASNNSDGDAQVPGAIGNTDSNRTDTLEIGLEFRL
DLRSEDLVTLKELGAGNGGTVSKVMHASTKVVMARKIIRVDAKENVRKQILRELQVGHDC
NSPHIVTFYGAFQNEARDIVLCMEYMDCGSLDRISKDFGPVRVDVLGKITESVLAGLVYL
YEAHRIMHRDIKPSNILVNSRGNIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGAY
TVRSDVWSVGLTVMELAVGRFPFDTSDSSAGDRASAGPMGILDLLQQIVHEPAPKLPKSD
AFPPILHEFVAKCLLKKSEERPTPRELYDKDAFLQAAKRTPVDLQEWAISMMERHNRKSY
LAPPPPKSLKDEPPAARSTPSPKPQPQQQPSSKPMRTPQYAPSDIPSSVGRNSPSQYQYN
YAPANPSPRPPRSTRSPPISLEHLSLEDEYRSGRRPSRTPVGGPSSGLEPPMNPMGSRSA
SSHNTKSRMPLQSAALPVRNAPPPSGPSPSAPGNGSWQRQPNSMRGDHMTGAV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaattcaaggcgcgaacgctgaagcgcaagaacgtcaaaggccttgccctg
aacgcagctccgaagcccgcctccaataattccgatggcgatgctcaggttccaggcgcc
attgggaacaccgacagcaaccgcaccgatactctggagatcggcctcgagtttcgtctt
gacctgcgtagcgaggatctggttaccctgaaggagctgggcgctggaaatggtggtacg
gtctcaaaggtcatgcacgcctccacgaaggtggtcatggctcgaaagataatccgcgtc
gacgcaaaggagaatgtgagaaagcagatcttgcgggaactccaggttggacacgactgc
aattccccccacattgtcaccttctatggtgccttccagaatgaagccagagatattgtc
ttgtgtatggagtacatggattgcggctcgctcgatcgcatatccaaggactttggtccc
gtgcgggtagacgtgttgggcaaaatcactgagtcggtcctggccggtctggtgtacctg
tacgaagctcatcgtatcatgcatcgcgatatcaagccatccaacatcctcgtcaactcg
cgcggcaacatcaagctctgcgactttggcgttgcgactgagacagtcaactcgatcgct
gatacgttcgtcggcacctccacctacatggcccccgagcgtatccagggtggtgcgtac
actgtgcgctcggatgtgtggagtgtcgggttgacggtgatggaattggcggttggtcgc
ttcccctttgacacgtccgactcctcagcaggcgaccgtgccagcgccggtccgatgggt
attctggatctgctgcagcagattgtgcacgagcctgctccgaagttgcccaagagcgac
gccttccctcccatcctgcacgagtttgtcgccaaatgtctcctcaagaagtccgaggaa
cgccccacgcctcgcgagctttatgacaaggatgcgttcctgcaggccgccaagcggacg
ccggttgatctccaagaatgggccatcagcatgatggagcgacacaaccgcaagtcgtat
ctggctcccccgccgcccaagtcgctcaaggacgagcccccagctgcgcgatcgactccg
tccccgaagcctcaaccccagcagcagcccagcagcaagccgatgcgcactccccagtac
gcccccagcgacattccctccagcgtgggccgcaacagcccctcgcagtaccagtacaac
tacgcccccgccaacccatccccgcgtccaccccggtcaacacgctcgcctcccatctct
ctcgagcatctgtcgttggaagatgagtaccgctccggccgtcgtccctcacggactccc
gtcgggggcccctcttccggattggaaccccccatgaacccgatgggatctcgttccgcc
agctcacacaacacgaagtcgcgaatgcctctacagtcagcagcgctgcccgtgcgaaac
gcgcctcccccgagcgggccttcgccctctgctcctggaaatggatcctggcagcgccag
ccaaactccatgcgcggggaccatatgacgggtgccgtctag

DBGET integrated database retrieval system