KEGG   Aspergillus niger: ANI_1_1414034Help
Entry
ANI_1_1414034     CDS       T01030                                 

Gene name
An03g05300
Definition
tannase subunit
Orthology
K10759  
tannase [EC:3.1.1.20]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.20  tannase
     ANI_1_1414034 (An03g05300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 570 aa AA seqDB search
MSKFLLWTVSAAALARAATLEDVCTTAHAKAAVPVSGLVQGVVTNPSSITAAPVYNESTA
GSDYYPAGTYDYCNITMTYSHAGKDDSVLLQFWMPTPDDFQNRWVSTGGFGFAINVASNV
PAGLPYGAVAGRTDGGFGSFDTQFSSVYPLVNGTANYDALYMFGYQAHHEMSSIGKAFTK
NFYSMSDKLYAYYQGCSEGGREGWSQVQRFPEEWDGAVIGAPAIRYGQQQVNHLVPQVVE
QTLDYYPENCEFSEMVTLIIDACDELDGRKDGVISRTDLCQLNFDLKSTIGKPYACNAST
SMGVATPAQNGTITAEGVRVAQTILDGLKDSEGRQAYFWYRIGSEFTDAETSYDSTTGTY
GIDISELGGEWVTHGLQLLDLDNLSNLDNVTYDTLRDWMLEGLQRYEDVLQTTWPDLSRF
QAAGGKVIHYHGESDNSIPPASSVRYFESVRDTMFPNKTYNASVEALNEFYRLYLVPGAS
HCNTNSLQPNGPYPQNSLGDLMNWVEKGIEPVTLNGTVLSGDYEGEEQKICSWPLRPLWK
NNGTVMDCVYDQKSIDTWLYDLDAYDIPIY
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagttcctcctctggaccgtctctgcggcggccctcgcgcgcgccgcgactctt
gaagacgtctgtaccactgctcatgcgaaggccgctgtgcctgtctccggcttggtgcag
ggagtggtcaccaacccttccagtatcaccgcggcccccgtttacaatgaatccaccgcc
ggttccgactactacccggccggtacctatgattactgcaatatcaccatgacttattct
catgcgggcaaggacgatagcgtcctgctgcaattctggatgcccactcctgacgacttc
cagaaccgctgggtgtccaccggtggctttggctttgccatcaacgttgcctccaacgtg
cctgctggtcttccctacggtgccgtcgccggccggaccgacggtggctttggcagcttc
gacacccaattctcctctgtataccccctggtgaacggtaccgccaactacgacgctctg
tacatgttcggctaccaggcccaccacgagatgtcctccatcggcaaggccttcaccaag
aacttctacagcatgtccgacaagctctacgcctactaccagggctgctccgagggtggc
cgtgagggctggagtcaggtgcagcgcttccccgaggagtgggatggtgccgtcattggt
gcccctgccatccgttatggccagcagcaggtgaaccacctggtgccccaggtcgtcgag
cagaccctcgactactaccctgagaactgcgagttctctgagatggtgactctgatcatc
gacgcttgtgatgagctcgatggccgcaaggacggcgtcatctcccgcacggatctctgc
cagctcaacttcgacctcaagtcgaccatcggtaagccctacgcctgcaacgccagtacc
agcatgggtgtggctaccccggcccagaacggcaccatcactgctgagggtgtgcgcgtc
gcccaaaccattctggacggactgaaggactctgagggtcgccaggcctacttctggtac
cgcattggctccgagttcaccgacgcagagacctcgtacgattcgaccaccggcacctac
gggattgacatctctgagctgggtggtgagtgggtgactcacggactgcagctgctggat
cttgacaacctctcgaacctggacaacgtcacctacgacaccctgcgtgactggatgctc
gagggtctccagcgctacgaggatgtcctgcagaccacttggcccgatctgtcccgcttc
caggctgccggtggtaaggtgatccactaccacggcgaatcggacaacagcatccctcct
gcctcttcggtgcgttacttcgagtccgtccgcgacaccatgttccccaacaagacctac
aacgcctcggtcgaagccctgaacgagttctaccgcctctacttggtccccggtgcctcc
cactgcaacaccaactccctgcagcccaatggtccttacccccagaactctctcggcgat
ctgatgaactgggtcgagaagggcattgagccggtgactttgaacggaacggtgttgagc
ggcgactacgagggagaggagcagaagatctgctcgtggcctctgcgtcctctgtggaag
aacaacggcacggtcatggactgcgtgtacgaccagaagtcgattgacacctggttgtat
gatctggatgcgtatgacattccgatctactag

DBGET integrated database retrieval system