KEGG   Aspergillus niger: ANI_1_1432074Help
Entry
ANI_1_1432074     CDS       T01030                                 

Gene name
An08g10670
Definition
mitogen-activated protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ang  Aspergillus niger
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 354 aa AA seqDB search
MVQQMPPQGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSM
FCLRTLREMKLLRYFNHENIISILDIQRPRNYESFNEVYLIQELMETDMHRVIRTQDLSD
DHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGF
MTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDV
LGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFRAMFPKSNELALDLLEKLLAFNPAKRIT
VEEALRHPYLEPYHDPDDEPTAPPIPEGFFDFDKNKDALSKEQLKLLIYEEIMR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcaaatgcctcctcaaggggggtcgcgaaagatctctttcaacgtttccgac
cagtatgagatccaggatgtcattggtgagggagcttacggtgttgtatgctctgctatc
cacaagccttctggccagaaggtcgccatcaagaagatcacccccttcgaccactcgatg
ttctgcttgcggactctgcgtgagatgaagctgctgcgctacttcaaccatgaaaacatc
atttccattctggatatccagaggcctcggaattatgagagcttcaacgaggtgtatctg
attcaggaactgatggagacggatatgcaccgggtcattcgtactcaggacctctccgat
gaccactgccaatactttatctaccagaccttgcgtgcgctcaaggccatgcactccgcc
aacgtcctccaccgtgatctcaagccctccaaccttctcctcaatgcaaactgcgacctg
aaagtctgcgactttggtctggcccggtcagccgcatcaaccgacgacaactctggattc
atgacggaatacgtcgcgacacggtggtaccgtgccccggagatcatgttgacgttcaag
gaatacaccaaggcgatcgatgtctggagtgttggatgtatcctggcggaaatgctgagt
ggaaagccgctcttccccggaaaggactatcaccaccaactgactctgattcttgatgtc
ctgggcacgccaactatggaggactactacggcatcaagtctcgccgggctcgggagtac
attcgctcattgcccttcaagaagaagattcccttccgcgcaatgttccccaagagcaac
gagctggcgctggaccttttggagaagcttctggcgttcaaccctgcgaagcgtatcact
gtcgaggaggcgttgcgtcatccgtacctcgagccgtaccatgaccctgatgacgagcca
acggcgcccccgattcccgaaggcttctttgattttgacaagaacaaggatgcactcagc
aaggagcaactgaagctcctgatctacgaggagattatgcggtaa

DBGET integrated database retrieval system