KEGG   Aspergillus niger: ANI_1_1442184Help
Entry
ANI_1_1442184     CDS       T01030                                 

Gene name
An04g09690
Definition
pectinesterase A
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ang  Aspergillus niger
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ANI_1_1442184 (An04g09690)
   00500 Starch and sucrose metabolism
    ANI_1_1442184 (An04g09690)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ANI_1_1442184 (An04g09690)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MHTPYLLGALAALAATAVGAPAEHIKKRESRTSAPSGCLTVGSDGTYSTIGDALDALGSS
TSSACIYVASGTYEEQLTIDYAGNLTLYGETTDTSTYKDNVVTITHTISSSDAGSLDKSA
TVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYS
NCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVS
LTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDRE
YETSISAAVDKTTVLGETWGDWIDRSY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcatactccatatcttctgggcgcccttgccgccctggctgctaccgccgtcggtgct
ccggcagagcacatcaagaagcgagagagccggacgagtgctccctcagggtgtctgacg
gtcggatcggatggaacatattccaccatcggcgacgcgcttgacgctctaggctcatcc
acttcgtccgcttgcatttacgttgccagcggcacgtatgaggagcagctgaccattgac
tacgctggcaacctcaccttgtacggtgagactaccgacaccagcacatacaaggacaat
gtggtgaccattacccacaccatctcgtcgtcggatgccggctctctcgacaagagcgcc
accgtcaacgtggtctcggatgggttcagcatgtacaacatcaacgtggagaatggatat
ggtgagggagcacaggctgtagcccttgtcggaaacgcagatcaactgggcttctatgga
tgccaattcagtggttatcaagacactctctatgtcaaggccggtacccagtattactcc
aactgcatgatcgagggcgcggtcgactacatcttcggcgatgcgtccgtgtggttcggc
gaatgtgacattgtgtctaacggcgccggtgccatcacggcctcatcgcgcgaaacctcc
tctgactcaggctggtacgctatcgacaactgcaacatcaaggctgcttcgggagtctct
ctcacggaggaagtctacctgggccggccgtggcgcgtgctggcgcgagtcatctaccag
aactcagtgttgtcggacatcatcaaccccaagggatggacgaccatggcagacggtgcg
acgccgctgtattatgaatacaacaactctggtgcgggatcggacacatctgatcgcgaa
tacgagacctccatttctgctgcggttgacaagaccacagtgctgggcgagacttgggga
gactggattgatcggagctactaa

DBGET integrated database retrieval system