KEGG   Aspergillus niger: ANI_1_1442184Help
Entry
ANI_1_1442184     CDS       T01030                                 

Gene name
An04g09690
Definition
pectinesterase A
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ang  Aspergillus niger
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ang00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ang00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MHTPYLLGALAALAATAVGAPAEHIKKRESRTSAPSGCLTVGSDGTYSTIGDALDALGSS
TSSACIYVASGTYEEQLTIDYAGNLTLYGETTDTSTYKDNVVTITHTISSSDAGSLDKSA
TVNVVSDGFSMYNINVENGYGEGAQAVALVGNADQLGFYGCQFSGYQDTLYVKAGTQYYS
NCMIEGAVDYIFGDASVWFGECDIVSNGAGAITASSRETSSDSGWYAIDNCNIKAASGVS
LTEEVYLGRPWRVLARVIYQNSVLSDIINPKGWTTMADGATPLYYEYNNSGAGSDTSDRE
YETSISAAVDKTTVLGETWGDWIDRSY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcatactccatatcttctgggcgcccttgccgccctggctgctaccgccgtcggtgct
ccggcagagcacatcaagaagcgagagagccggacgagtgctccctcagggtgtctgacg
gtcggatcggatggaacatattccaccatcggcgacgcgcttgacgctctaggctcatcc
acttcgtccgcttgcatttacgttgccagcggcacgtatgaggagcagctgaccattgac
tacgctggcaacctcaccttgtacggtgagactaccgacaccagcacatacaaggacaat
gtggtgaccattacccacaccatctcgtcgtcggatgccggctctctcgacaagagcgcc
accgtcaacgtggtctcggatgggttcagcatgtacaacatcaacgtggagaatggatat
ggtgagggagcacaggctgtagcccttgtcggaaacgcagatcaactgggcttctatgga
tgccaattcagtggttatcaagacactctctatgtcaaggccggtacccagtattactcc
aactgcatgatcgagggcgcggtcgactacatcttcggcgatgcgtccgtgtggttcggc
gaatgtgacattgtgtctaacggcgccggtgccatcacggcctcatcgcgcgaaacctcc
tctgactcaggctggtacgctatcgacaactgcaacatcaaggctgcttcgggagtctct
ctcacggaggaagtctacctgggccggccgtggcgcgtgctggcgcgagtcatctaccag
aactcagtgttgtcggacatcatcaaccccaagggatggacgaccatggcagacggtgcg
acgccgctgtattatgaatacaacaactctggtgcgggatcggacacatctgatcgcgaa
tacgagacctccatttctgctgcggttgacaagaccacagtgctgggcgagacttgggga
gactggattgatcggagctactaa

DBGET integrated database retrieval system