KEGG   Aspergillus niger: ANI_1_1448024Help
Entry
ANI_1_1448024     CDS       T01030                                 

Gene name
An02g10310
Definition
glycogen [starch] synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ang  Aspergillus niger
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANI_1_1448024 (An02g10310)
Enzymes [BR:ang01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ANI_1_1448024 (An02g10310)
Glycosyltransferases [BR:ang01003]
 Polysaccharide
  Storage polysaccharide
   ANI_1_1448024 (An02g10310)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 713 aa AA seqDB search
MASEDNGQEPIKRDVRNHILFEVATEVANRVGGIYSVLKSKAPVTTAEYGDRYTLIGPLN
RASAAVEVEELTPSNPRMIETIQSMKERGIEIVYGRWLIEGAPRVLLIDTGTGYKYLDEW
KGDLWNAAGIPSPSADSETNEAIVFGYLVAWFLGEFIAHERRRAVVAHFHEWLAGVALPL
TKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAAAH
TADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAVHEFQNLHSQSKEKINDFVRG
HFYGHNNFDLDNTLYVFTAGRYEFRNKGVDMFIEGLARLNHRLKEAGSKMTVVAFIIMPA
QTSSLTVEALKGQAVVKSLKDTIEMIEKGIGRRMYERCLAWKEGDNMPDEKDLMASQDRV
LLRRRLFAMKRHSLPPIVTHNMYNDHEDPILNQIRRVQLFNHESDRVKVVFHPEFLNSSN
PVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSS
DYGIYIVDRRMKGVDDSVNQLTEFMFNFTQKSRRQRINQRNRTERLSDLLDWKRMGLEYV
KARQLALRRAYPSSFGTPDDVYDVIGGTEQKISRPLSVPGSPRDRSGMMTPGDFASLQEV
KEGLSTEDYVAWRLPTSEEEEPDDQYFPLTLRTKKNTDRPASPLDQLSVNGDS
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgaggataacggccaagagcctataaagcgcgatgttcgcaatcacattcta
ttcgaggtagctacggaagtggccaaccgggtgggaggcatttactcggtgcttaagtcg
aaagctcccgtgacgaccgcagagtatggcgaccgttacaccctgatcggtcctctcaat
cgtgcttcggcagctgtggaggtcgaggagttgactccgtcgaatccccgcatgattgag
accatccagtccatgaaggagcgtgggatcgagatcgtctacggtcgctggctgattgag
ggtgctccacgcgtgcttcttatcgatacaggcactggctacaaatatttggacgagtgg
aaaggtgatctctggaacgcagctggtatcccgtccccttccgccgatagcgagaccaac
gaagccattgtgtttggctacctggtggcatggttcctaggcgagttcatcgctcatgag
cgccgccgtgcggtggtggctcattttcacgaatggcttgctggtgtcgctttgccgctg
accaagaagcggcatatggatctgacaacaattttcaccacccacgcgaccttgctcggt
cggtatctgtgcgctgggtctgtggacttctataacaatctccagtactttgatgttgac
gcggaagctggcaaacgtgggatctaccaccgctactgtattgagcgagctgccgcacac
acagctgacgtcttcacgactgtgtcccatatcacggcctttgagagtgagcatctcctt
aagcggaagcctgatggggtgctgcccaacggattgaacgtgaagaagttctcggctgta
catgaattccagaacctacattcgcagtccaaggagaagatcaatgactttgtgcggggg
catttctatggtcacaacaactttgacttggacaataccctctacgtatttacagctgga
cgctatgagttccgaaacaagggtgtggatatgttcatcgagggcctggcgcgtttgaat
caccgtctgaaagaggccggttccaagatgaccgtcgtcgcgtttatcatcatgcccgct
cagacgtcatccctgaccgtcgaagctctcaagggccaagctgttgtgaagtctctgaag
gacacaatcgagatgatcgagaagggcattgggaggcgaatgtacgagcggtgtcttgcg
tggaaggaaggcgacaacatgccggacgagaaagatctgatggctagccaggatcgtgtg
ctactgcgccgcaggctcttcgccatgaagcgacactccctgcctccgattgtcacgcac
aacatgtacaatgatcacgaagacccaattctgaaccagatccgtcgtgtccaacttttc
aaccacgagtcagaccgggtcaaggttgtcttccacccggagttcctgaactcgtccaac
ccggtgctacccttggactatgacgacttcgttcggggtactcatctcggagtgttcccc
tcgtactacgagccttggggatatacgccggctgaatgcaccgtgatgggtgtcccgagt
atcaccacaaacctgtctggtttcggttgctatatggaggaactaattgagaattcgtcc
gactacggaatctatattgtggaccgtcggatgaaaggcgtggatgactcagtcaatcaa
ctgacggaattcatgttcaacttcacccagaagagtcggcgccagcggatcaaccagcgg
aaccggacagagcgtctgagtgacctcctggactggaaacgcatgggccttgagtatgtc
aaggctcggcagttggcactccgtcgagcctatccttcgtctttcggcacgcctgatgat
gtttacgacgtaatcggtggcacggagcagaagatatcgcgaccattatccgtacccgga
tccccgcgagatcgttctggtatgatgactcccggggattttgcctctttgcaggaggtg
aaagaaggcctgagtacggaggactatgtcgcatggcgactgccaactagcgaggaagag
gagccagatgaccagtatttcccgctcaccctgcgcacgaagaagaataccgaccgtccg
gcgtcgccgctcgatcagctgtcggtcaatggtgacagttga

DBGET integrated database retrieval system