KEGG   Aspergillus niger: ANI_1_1482094Help
Entry
ANI_1_1482094     CDS       T01030                                 

Gene name
An11g11280
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ang  Aspergillus niger
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANI_1_1482094 (An11g11280)
  Amino acid metabolism
   00310 Lysine degradation
    ANI_1_1482094 (An11g11280)
Enzymes [BR:ang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ANI_1_1482094 (An11g11280)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 469 aa AA seqDB search
MASRLPFHRLSGQHLRTLHRNNSVSRSLHIGRARSLTSVALQKSVNGSLKSSASLQQVTA
LGPKMSRFSIAPFGATQVRTYADTVVKVPQMAESITEGTLKQFSKQIGDYVERDEEIATI
ETDKIDVSVNAPESGTIKEFLVSEEDTVTVGQDLVKLELGGAPETKKEDATEKPAAPAAA
DKPTASEPEKPKAPEAPQSSSQKATPPEPSPSKKTEPAATKPQVSEDAKPSVGGREERRV
KMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKDDVLKKTGVKLGFMSAFS
RACVLAMKDVPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGI
EKAIADLGKKARDNKLTIEDMAGGSFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDKP
VAVNGKVEIRPMMYLALTYDHRLLDGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgattaccgtttcatcgcctctctgggcaacacctgaggactcttcatcga
aacaacagcgtttcccgcagcctccacatcggccgcgccagaagcttgacgtctgttgca
ctccagaagagcgttaatggttctctcaagtcaagcgcgagtctccagcaggttacggct
ctggggcccaaaatgtctcgcttcagtatcgctcctttcggggctactcaggtgcggact
tatgcggacactgttgtcaaggttccgcagatggcggaatcgatcaccgaagggacattg
aagcaattctccaaacagatcggtgactacgttgaacgggacgaggagatcgcaaccatt
gagactgacaagattgatgtatccgttaatgcccctgaatccggtaccatcaaggagttc
ctcgtgagcgaggaagacaccgtcacagttggacaggaccttgtcaaattggagcttggt
ggcgcccctgaaaccaagaaggaagacgcaactgaaaagccggccgcgccagctgctgct
gacaagcccacggcttccgaacctgagaaacctaaggcacccgaggcaccccagtcttcc
tcccagaaggccacacctccggagcccagtccctcaaagaaaacagagccggcagctaca
aagccgcaggtctccgaagatgcgaagcccagcgttgggggtcgcgaagagcggagggtg
aaaatgaacaggatgagattaagaatcgcggaacgtctgaagcagtcccagaacacggca
gcttctctcaccacattcaacgaagtcgacatgtcctctctgatggagttccgcaagctg
tacaaggacgatgtattgaagaagactggtgtcaaactcggattcatgagtgccttttct
cgcgcttgcgttcttgccatgaaagacgttcctgctgttaatgcctccattgaaggtccc
aatggtggggacactatcgtttatcgtgattacgtggatatcagtgtggccgttgccact
gagaaaggactcgtgacaccagtggtccgcaatgcggagaccatggacctcgttggcatt
gagaaagcaatcgcggatcttggcaagaaggctcgtgacaataagttgactatcgaggac
atggctggaggctctttcaccattagcaatggcggagtttttggctctctgatgggaact
cccattattaatctcccacagacagctgttctcggactccacgcaatcaaagacaagccg
gtggctgtgaacggtaaagttgaaattcgccctatgatgtatcttgccctgacttacgat
caccgactcttggacggccgtgaggctgtgactttcttggttaaggtcaaggaatacatt
gaagacccccgtcggatgctgctggggtag

DBGET integrated database retrieval system