KEGG   Aspergillus niger: ANI_1_1482094Help
Entry
ANI_1_1482094     CDS       T01030                                 

Gene name
An11g11280
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ang  Aspergillus niger
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANI_1_1482094 (An11g11280)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ANI_1_1482094 (An11g11280)
  Amino acid metabolism
   00310 Lysine degradation
    ANI_1_1482094 (An11g11280)
Enzymes [BR:ang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ANI_1_1482094 (An11g11280)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MASRLPFHRLSGQHLRTLHRNNSVSRSLHIGRARSLTSVALQKSVNGSLKSSASLQQVTA
LGPKMSRFSIAPFGATQVRTYADTVVKVPQMAESITEGTLKQFSKQIGDYVERDEEIATI
ETDKIDVSVNAPESGTIKEFLVSEEDTVTVGQDLVKLELGGAPETKKEDATEKPAAPAAA
DKPTASEPEKPKAPEAPQSSSQKATPPEPSPSKKTEPAATKPQVSEDAKPSVGGREERRV
KMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKDDVLKKTGVKLGFMSAFS
RACVLAMKDVPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGI
EKAIADLGKKARDNKLTIEDMAGGSFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDKP
VAVNGKVEIRPMMYLALTYDHRLLDGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgattaccgtttcatcgcctctctgggcaacacctgaggactcttcatcga
aacaacagcgtttcccgcagcctccacatcggccgcgccagaagcttgacgtctgttgca
ctccagaagagcgttaatggttctctcaagtcaagcgcgagtctccagcaggttacggct
ctggggcccaaaatgtctcgcttcagtatcgctcctttcggggctactcaggtgcggact
tatgcggacactgttgtcaaggttccgcagatggcggaatcgatcaccgaagggacattg
aagcaattctccaaacagatcggtgactacgttgaacgggacgaggagatcgcaaccatt
gagactgacaagattgatgtatccgttaatgcccctgaatccggtaccatcaaggagttc
ctcgtgagcgaggaagacaccgtcacagttggacaggaccttgtcaaattggagcttggt
ggcgcccctgaaaccaagaaggaagacgcaactgaaaagccggccgcgccagctgctgct
gacaagcccacggcttccgaacctgagaaacctaaggcacccgaggcaccccagtcttcc
tcccagaaggccacacctccggagcccagtccctcaaagaaaacagagccggcagctaca
aagccgcaggtctccgaagatgcgaagcccagcgttgggggtcgcgaagagcggagggtg
aaaatgaacaggatgagattaagaatcgcggaacgtctgaagcagtcccagaacacggca
gcttctctcaccacattcaacgaagtcgacatgtcctctctgatggagttccgcaagctg
tacaaggacgatgtattgaagaagactggtgtcaaactcggattcatgagtgccttttct
cgcgcttgcgttcttgccatgaaagacgttcctgctgttaatgcctccattgaaggtccc
aatggtggggacactatcgtttatcgtgattacgtggatatcagtgtggccgttgccact
gagaaaggactcgtgacaccagtggtccgcaatgcggagaccatggacctcgttggcatt
gagaaagcaatcgcggatcttggcaagaaggctcgtgacaataagttgactatcgaggac
atggctggaggctctttcaccattagcaatggcggagtttttggctctctgatgggaact
cccattattaatctcccacagacagctgttctcggactccacgcaatcaaagacaagccg
gtggctgtgaacggtaaagttgaaattcgccctatgatgtatcttgccctgacttacgat
caccgactcttggacggccgtgaggctgtgactttcttggttaaggtcaaggaatacatt
gaagacccccgtcggatgctgctggggtag

DBGET integrated database retrieval system