KEGG   Aspergillus niger: ANI_1_1488094Help
Entry
ANI_1_1488094     CDS       T01030                                 

Gene name
An11g11310
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
ang  Aspergillus niger
Brite
Chromosome and associated proteins [BR:ang03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    ANI_1_1488094 (An11g11310)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ANI_1_1488094 (An11g11310)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa RP-C
Motif
Other DBs
NCBI-GeneID: 4985348
NCBI-ProteinID: XP_001395088
UniProt: A2QY49
AA seq 141 aa AA seqDB search
MPPKAAEKKPSTGGKAPAGGKAPAEKKEAGKKTAAAASGDKKKRGKTRKETYSSYIYKVL
KQVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGE
LAKHAVSEGTKAVTKYSSSAK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaagccgctgagaagaagcccagcaccggtggcaaggccccggcaggcggc
aaggctcccgctgagaagaaggaagccggcaagaagactgctgccgctgcctccggcgac
aagaagaagcgtggaaagaccaggaaggagacctactcgtcttacatctacaaggtcttg
aagcaggtccaccctgataccggtatctcgactcgtgctatgtccatcctgaactccttt
gtcaatgatatcttcgagcgtgtcgcgaccgaggcctcgaaacttgccgcttacaacaag
aagtccaccatctcttcacgggagatccagacctctgtgaggctcatccttcccggtgaa
ttggcgaagcacgcggtgtcggaaggcaccaaggctgtcacgaagtactcgtcgtctgcc
aaataa

DBGET integrated database retrieval system