KEGG   Aspergillus niger: ANI_1_1504014Help
Entry
ANI_1_1504014     CDS       T01030                                 

Gene name
An01g11150
Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ang  Aspergillus niger
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ANI_1_1504014 (An01g11150)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     ANI_1_1504014 (An01g11150)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 760 aa AA seqDB search
MPSVTDQTGLSGLEFDGPQPILGTGLNVSPQRHHHTNGHETSAIASEGTAFRHRVSAPKK
PAARLPTHQPASLSSQTSSIITEPAHRHERDGISKNGEEDPQNSLFAQVYEWLQREKSKR
RSHKATSLATMDGVASDGDDDDDDSASVLVERPLSSGADTTMALDKLEKILIQYATSRQG
TDSVHLTRRSGRRRQYSKGLRRGSASESDFSDHEAAAPSVDAVLDNSKTLAYSGGGTEDD
DNENSVNARRAKDKEAWTLFKSEILRLAHTMQLKGWRKLPMELATDIGVVRLSGALTNAV
YVVTPPQNIPVPKAEDGSYSLVPRKPPPKLLLRIYGPQVDHLIDRDNELQILRRLGRKNI
GPKVLGTFNNGRFEEYFEARPLTPKELRDPPTMKQIAKRMRELHDGIDLLVDEREGGPMV
FKNWDKWVDRCEQVINWLDKEIRSEHNKSKAASEAWRRRGFVCGVPWPSFRKAVEGYRKW
LLSSCGGMDGIKRQLVFAHNDTQYGNLLRMEPSHESPLLRPENVHKQLVVIDFEYASANT
PGIEFANHFTEWCYNYHDPERPWACDTSRYPNPEQQHQFIEAYLSHRPGLREQASPSITP
LMRGLSTNTSSLAPLSLDDGPDVDVSARFDIEKAHEDSTSAKIQYYARQTRLWRVLNSAQ
WVAWGIVQAKVPGMEEGIAADEAAAKAQNGHHGTNAEVNHSTGTPPVDADVDEAEEFDYL
GYAQDRAMFFWSDLLALKIIREDELPESLVQVIKSRMIDY
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgccctcagtcaccgaccagaccggtctttctggtcttgaatttgatggaccacaacct
attctggggactggtttgaatgtctccccccagagacatcaccacacaaatgggcacgaa
acttccgcaattgcgtcagaaggaactgcattcaggcatcgtgtctccgcacccaagaaa
ccggcagccagactacctacgcaccagccggcttctttaagtagtcagacatccagcatc
atcactgaacccgcgcatcgtcatgaaagggatggcatttcgaaaaatggcgaggaagac
ccgcagaatagccttttcgcacaagtctacgaatggcttcagcgcgaaaaatccaagcgg
aggtctcacaaggcgacaagtttagcaacgatggatggtgttgccagtgatggtgacgat
gacgacgatgacagcgctagcgtccttgtggaaagacctttatcatctggtgctgacact
acaatggcactcgacaagctggaaaagattctcattcagtacgccacttcacggcaggga
accgactctgtacacctcacccgacgatccggtcgtcggcgtcagtactccaaggggttg
cgtaggggttctgcgtctgaatctgacttttcagaccacgaggcggccgcccctagcgtg
gatgctgtgctggataattcaaaaactctcgcgtatagcggtggtggtacagaagatgac
gacaacgagaacagtgtcaatgcgagacgcgcaaaggataaggaagcctggacacttttc
aagagtgaaatccttcggctcgctcacaccatgcagctgaaaggatggcggaagcttccc
atggaacttgcaaccgatataggagttgttcgacttagtggtgccctgaccaatgccgta
tatgtagtcacaccgccacagaatattcctgtgcctaaggcggaagatggatcatactca
ttggtacccagaaaacccccaccgaagctcttgctccgtatctatgggccacaagtggat
cacttgattgatcgagataacgagctccaaatcctccgccgtctaggccgaaagaacatt
ggtccgaaggtgctgggtacattcaataacggaagattcgaagagtacttcgaagctcgc
ccacttacgcctaaggagctccgcgatcccccgaccatgaagcagattgcgaagcggatg
agggagctgcacgatggaatcgatcttcttgtagacgagagggaaggaggacccatggtg
ttcaagaactgggataagtgggtagaccgctgcgagcaagtaatcaattggctggacaag
gagattcgatccgagcacaacaagagcaaagcagcatccgaggcttggcgccggcgaggc
tttgtctgcggtgttccctggccctccttcaggaaggcagttgaaggatatcgtaagtgg
cttttgtccagctgtggaggcatggacggaataaagcgacagttggtgtttgcgcacaat
gatactcaatatggcaatctgcttcggatggagcccagccacgaatcaccgctgcttcgg
cctgagaacgtgcataagcagctcgtcgttattgatttcgagtatgcatcggcaaacact
ccaggaatcgagtttgccaaccatttcactgaatggtgctacaactatcatgatccggag
cggccgtgggcatgcgacaccagccgctatccgaatccagagcagcagcatcagttcatt
gaagcgtatctgagccatcgacccggattgcgcgagcaggcatctccttctatcacccct
ctgatgcgaggtctctctaccaacacttcatcactagctcctttgagcctggatgacggc
ccggatgtcgacgtgtctgctcggttcgatatcgagaaagcgcacgaggacagcaccagc
gctaagatccaatattacgcgcgacaaaccagattgtggcgggtactcaactccgcgcag
tgggtagcttggggaatcgtgcaggccaaggtgcctggcatggaggagggaatcgccgca
gatgaagctgcagctaaagcccagaacggccaccatggtaccaatgctgaagtgaaccac
tccaccggaaccccgccagtggatgccgatgtggacgaagccgaagagtttgactacctg
ggctatgcgcaggaccgggcgatgttcttctggtctgatttgctggcgctgaagatcatc
cgagaggatgagctgcccgaatctctggtacaagtgatcaaatctcgcatgatcgactat
taa

DBGET integrated database retrieval system