KEGG   Aspergillus niger: ANI_1_152134Help
Entry
ANI_1_152134      CDS       T01030                                 

Gene name
An15g00870
Definition
calcineurin subunit B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ang  Aspergillus niger
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 193 aa AA seqDB search
MDHSSEPNNAALYDARRRRGSVGTSQLFDNIVSASNFDRDEVDRLRKRFMKLDKDSSGTI
DRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKV
YDIDRDGFISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDGDGKISFEEFTDMVE
NTDVSLSMTLNQI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggatcattccagcgaacccaacaacgcggccctttacgatgcgcggagacgcaggggc
tccgtcggaacttctcagctcttcgacaacattgtgtccgcctccaacttcgatcgcgat
gaagtggaccgtctccgcaagcgctttatgaagcttgataaggacagctccggcaccatc
gaccgcgatgaattcctctcccttcctcaagtctcctccaacccgctcgccacgagaatg
attgccattttcgacgaagacggcggcggcgatgtcgacttccaagaattcgtctccggg
ttatcagccttcagttccaagggcaacaaagaagagaagctgcgcttcgcattcaaagtg
tacgatatcgatcgcgacgggtttatctccaatggcgaattgttcatcgtgctgaagatg
atggtcggcaataacttgaaggatgtgcagttgcagcagattgtcgacaagacgatcatg
gaggccgataaggatggtgatggcaagattagcttcgaggagtttacggatatggtcgag
aacacggatgttagtttgagtatgacgttgaaccagatctga

DBGET integrated database retrieval system