KEGG   Aspergillus niger: ANI_1_1528124Help
Entry
ANI_1_1528124     CDS       T01030                                 

Gene name
An14g05810
Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ang  Aspergillus niger
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 413 aa AA seqDB search
MDGAELQSPLLDNGQPPLVAKRVTSEEPNAAADAKRLKTSDDREAPPQTNLPAATRIVPF
PEKPAVVEERNCEIEFRVVNNDGSTESTVILTGLKNLFQKQLPKMTKDYIARLVYDHTHL
SLAICKMPLEIIGGITFREVRHRRFAEIVFCAASSDQQVKGYGAHLMAHLKDYVRATSPV
MHFLTYADNYATGYFQKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLEVGRM
LLKQKACVLAKLRPLSRNHIVHPPPPQWANGIVTLIDPLSIPAIRATGWSPDMDELARQP
RHGPHFNELRRFLSKIQAHKQAWPFLSPVNKDEVPDYYNFIESPMDLSTMEERLENDTYS
TPKELINDLKSIFRNCRQYNDATTIYAKSATKLEKYIYSLIKEVPEWFDLVKE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggacggagccgagttgcaatcacccctactcgataatggacaacccccccttgtcgcg
aagcgcgtaacttctgaagagccgaatgctgccgccgatgccaaaagactcaaaacatct
gatgatagggaggcaccgccgcagacaaaccttcccgcggcaacccggattgttcccttt
ccagagaaacctgcagttgtagaagaacggaactgcgaaatagaatttcgggttgtcaac
aacgatggttccacggagagtactgtcattctaacaggtctcaagaatctgtttcaaaaa
cagctaccgaagatgaccaaagattacatcgcccgtctcgtctatgatcacactcacttg
tctttggccatctgcaaaatgcccctggaaattattggcggaatcacattcagagaggtc
cgacatcgcaggttcgctgaaattgtgttctgtgcggcttcatcggaccagcaggtgaag
ggatacggggcgcatctcatggcccacttgaaggactatgtcagagccacatccccagtg
atgcattttctaacttacgctgataactacgcaaccggttatttccaaaaacaaggcttc
acgaaagagatcacgcttgacaagtccatctggatgggttatattaaggattatgaaggc
ggtacactcatgcaatgttctatgctcccccgaatacggtatctggaagttggtcgtatg
cttctcaagcagaaggcatgtgttctagctaaattacgccctttgagcagaaatcatatt
gtacatcccccgcctccacaatgggccaacggcatcgtcactctgatcgatccactctct
attcctgctattcgggctactggatggtctccggacatggacgagctagcacggcaacca
cgacatggacctcattttaacgagcttcgacgttttcttagcaaaatacaagcccacaaa
caagcgtggccctttctctctcctgtcaacaaagatgaggtcccggattactacaacttc
atcgaatctccaatggatctatcaacgatggaggaaagattggagaatgacacatattct
accccaaaagagcttattaacgatctcaagtcaatctttcgcaattgtcggcagtataat
gatgcaacgacgatttatgccaaaagcgcgacaaagctggagaaatatatatattctcta
atcaaggaggtaccagagtggtttgacttggtgaaagagtga

DBGET integrated database retrieval system