KEGG   Aspergillus niger: ANI_1_1552024Help
Entry
ANI_1_1552024     CDS       T01030                                 

Gene name
An02g11150
Definition
alpha-galactosidase B
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ang  Aspergillus niger
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ANI_1_1552024 (An02g11150)
  Lipid metabolism
   00561 Glycerolipid metabolism
    ANI_1_1552024 (An02g11150)
   00600 Sphingolipid metabolism
    ANI_1_1552024 (An02g11150)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    ANI_1_1552024 (An02g11150)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ANI_1_1552024 (An02g11150)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 443 aa AA seqDB search
MRWLLTSSALLVPAAALVRPDGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKD
LGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTT
CAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCV
NLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRM
SGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKA
PLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWS
GPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGC
VKDKYEVKLQAHDVAVLVVGGQC
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggcttctcacctcgtccgcactgttagtgccggccgcagccctggttcgaccc
gatggcgtgggccgcactcctgcccttggctggaactcttggaacgcatacagctgcgac
attgatgccgacaaaatcgtgactgccgccaacgaggtggtcaatctggggttgaaggac
ctgggatatgagtatatcaacatcgacgactgctggtccgtcaaatccggccgcaacacc
accaccaaacgcatcatccccgacccagacaaattccccaatggcatctccggcgtcgca
gaccaggtgcacgctttgggattgaagctgggaatctacagcagcgccggcctcaccacc
tgcgccggctaccccgccagtctaggctacgaagaaatcgacgcgcaatcctttgccgaa
tgggggattgactacctaaaatacgacaactgcggcgtccccaccaacctcacagaccaa
tacacctactgcgtccccgacagcaccgacggctccaactaccccaacggcacctgcgtg
aacctcacggacgccgcaccccaggggtacgactgggccacctccaccacggcgaagcgg
taccagcgcatgcgcgatgccctgctcagtgtgaacaggacgatcctgtactcgctatgt
gactggggccaggcggatgttaatgcctggggaaatgcaacgggaaatagttggcgcatg
tcaggggatatcacggcaacctggtcccgcatcgccgaaatcgccaacgaaaacagcttc
ctcatgaactacgccaacttctggggctatccggacccagacatgctggaagtgggcaat
gggaatctgacacttcccgagaatagagcgcattttgccctttgggcgatgatgaaggcg
ccgttgattattgggacgcctttggattcaatcgatacctcccacctcactatcctctcc
aacaaacccctgctcaccttccaccaagacgctgtgatcggtcgtcctgcgtacccgtat
aaatggggatataatcccgattggacgtttgatccggagcatccggcggagtattggtct
gggccgacttcttctggggaggtgtttgtgttgatgttgaattcggagggggaggtcaag
actcgctcggcggtttgggaggaggtgcctgagttgaaggacagaggtacgaagaagaat
tcgaaggagaagaaggggtttaaggtgacggatgcgtggacgggcaaggacctggggtgt
gtcaaggataagtatgaggttaagttgcaggcgcatgatgtcgcggttttggtggtggga
gggcaatgttag

DBGET integrated database retrieval system