KEGG   Aspergillus niger: ANI_1_1552024Help
Entry
ANI_1_1552024     CDS       T01030                                 

Gene name
An02g11150
Definition
alpha-galactosidase B
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ang  Aspergillus niger
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ang00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ang00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ang00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ang00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 443 aa AA seqDB search
MRWLLTSSALLVPAAALVRPDGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKD
LGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTT
CAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCV
NLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRM
SGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKA
PLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWS
GPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGC
VKDKYEVKLQAHDVAVLVVGGQC
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggcttctcacctcgtccgcactgttagtgccggccgcagccctggttcgaccc
gatggcgtgggccgcactcctgcccttggctggaactcttggaacgcatacagctgcgac
attgatgccgacaaaatcgtgactgccgccaacgaggtggtcaatctggggttgaaggac
ctgggatatgagtatatcaacatcgacgactgctggtccgtcaaatccggccgcaacacc
accaccaaacgcatcatccccgacccagacaaattccccaatggcatctccggcgtcgca
gaccaggtgcacgctttgggattgaagctgggaatctacagcagcgccggcctcaccacc
tgcgccggctaccccgccagtctaggctacgaagaaatcgacgcgcaatcctttgccgaa
tgggggattgactacctaaaatacgacaactgcggcgtccccaccaacctcacagaccaa
tacacctactgcgtccccgacagcaccgacggctccaactaccccaacggcacctgcgtg
aacctcacggacgccgcaccccaggggtacgactgggccacctccaccacggcgaagcgg
taccagcgcatgcgcgatgccctgctcagtgtgaacaggacgatcctgtactcgctatgt
gactggggccaggcggatgttaatgcctggggaaatgcaacgggaaatagttggcgcatg
tcaggggatatcacggcaacctggtcccgcatcgccgaaatcgccaacgaaaacagcttc
ctcatgaactacgccaacttctggggctatccggacccagacatgctggaagtgggcaat
gggaatctgacacttcccgagaatagagcgcattttgccctttgggcgatgatgaaggcg
ccgttgattattgggacgcctttggattcaatcgatacctcccacctcactatcctctcc
aacaaacccctgctcaccttccaccaagacgctgtgatcggtcgtcctgcgtacccgtat
aaatggggatataatcccgattggacgtttgatccggagcatccggcggagtattggtct
gggccgacttcttctggggaggtgtttgtgttgatgttgaattcggagggggaggtcaag
actcgctcggcggtttgggaggaggtgcctgagttgaaggacagaggtacgaagaagaat
tcgaaggagaagaaggggtttaaggtgacggatgcgtggacgggcaaggacctggggtgt
gtcaaggataagtatgaggttaagttgcaggcgcatgatgtcgcggttttggtggtggga
gggcaatgttag

DBGET integrated database retrieval system