KEGG   Aspergillus niger: ANI_1_1580074Help
Entry
ANI_1_1580074     CDS       T01030                                 

Gene name
An08g00300
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ang  Aspergillus niger
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ANI_1_1580074 (An08g00300)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ANI_1_1580074 (An08g00300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 200 aa AA seqDB search
MATSAVHKFRPVVVSGPSGTGKSTLLKRLFSEIPDRFGFSISHTTRAPRPGEQDGREYYF
TTKEDFLDLVSKNGFIEHAQFGGNHYGTSVQAVKNIAEQGRICILDIEMEGVKQVKRTDL
NARFLFLAPPSVEELEKRLRGRGTETEESLTKRLTQAKNELEYAKQPGAHDKTVVNDDLE
KAYTELRDWIVDGGNFGASQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagtgctgtgcacaagttccgtccggtggtggtgtctggcccctcaggtaca
ggaaaatcgactctgttgaagcgactgttctccgagattcctgatcgcttcgggttttcc
atctcgcataccactcgtgcgcctagaccgggtgagcaggatggccgcgaatactacttt
acgacaaaggaggacttcttggatcttgtgagcaagaacggcttcatcgagcatgcacaa
tttggcggaaaccactacggtaccagcgtgcaagccgttaagaacattgcggagcagggc
cggatctgtatccttgatattgagatggagggagtgaagcaggtgaagcgtaccgacctt
aacgctcgtttcctgttcctggcgcccccctcggtggaggagctggagaagagattgcgc
gggagaggcacggagactgaggagagcttgaccaagcgtctcacacaggccaagaacgag
ctcgaatacgctaagcagccgggggctcacgacaaaactgttgtaaatgacgacttggag
aaggcgtatacggagttgagggattggatcgttgacggtggcaactttggtgcgtcgcaa
tag

DBGET integrated database retrieval system