KEGG   Aspergillus niger: ANI_1_1594124Help
Entry
ANI_1_1594124     CDS       T01030                                 

Gene name
An14g06290
Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ang  Aspergillus niger
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANI_1_1594124 (An14g06290)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ANI_1_1594124 (An14g06290)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ANI_1_1594124 (An14g06290)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ANI_1_1594124 (An14g06290)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     ANI_1_1594124 (An14g06290)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 499 aa AA seqDB search
MLLRRSICRFSTPSSWISRVSPATMPLRAKLTNPAFGATASMSTAPIPKELPGDEPDDVL
FHSHYGVRLIELNRPKKLNSLNGSMVRKIVPRLKEWEKSDLANVIMLSGAGSKALCAGGD
VAALALQNEKGPEGQQASSDFFADEYRLDHLIATYQKPFVSVMDGITMGGGVGLSVHAPF
RIATERTVFAMPETTIGFFPDVGGSFFLSRLDGELGTYLALTSERLHGVQALYAGVATHY
LHSSALANLTARLSELVFRDYSTFQDRLALVNKTMAEFSTGVPSVREEPIQLAGKLRSAI
DRCFQYNTVEEIIQALQKETEMKSWAEKTLETLSARSPTSLKVALRQLRVGRQWTISETF
QREHAIASKFMRHPDFVEGVKARLMSKPPRQATWQPATLEEVSTEAIDQFFEIPESASGP
ESRLSLYHYKSPYTQYPYKFGLPSESRIEAFVRHRGRKGDLTLKEIVSNFDSKEGVKEKV
AEVLARRTVRDEAGLHWVN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttactccgacgcagtatttgccggttttcaacaccgtcgagctggatctcgcgggtt
tcaccagctaccatgcctctccgtgccaaactcacaaacccagcattcggggccactgct
agtatgtctacggcacctatccccaaagaactccccggagacgagcccgacgatgtcctg
ttccactctcactacggtgtgcggctgattgagctcaaccgtcccaagaagctcaattcc
ttgaacggctcgatggttcggaagattgtgcctcgactgaaggaatgggaaaaatccgac
ctggccaatgtcatcatgctctctggcgctggctcgaaagctctgtgcgccggaggagat
gtggctgccctggctctgcagaacgagaagggccccgagggccagcaggcctcgtccgac
ttcttcgccgacgaataccgtctcgatcatctcatcgcgacctaccagaagcccttcgtc
tccgtgatggatggtatcaccatgggcggcggtgtcggtctcagtgtccacgctcccttc
cggatcgccactgaacgcaccgtgttcgccatgcccgagaccaccattggcttcttcccg
gatgttggcggctcctttttcctgtcccgtctcgatggagagctcggaacatacctggcc
cttacctcggagcgcctccacggcgttcaggccctgtatgccggagttgccacgcactac
ttgcactccagcgcgctggccaacctgacggcccgtctgtctgagctcgtcttccgtgac
tactccacattccaggaccgtctcgctcttgtcaacaaaactatggccgaattctcgacg
ggtgtgccgtccgtgcgcgaggagcctatccaactggctggcaagctgcgcagtgctatt
gatcgctgcttccagtacaacacggtggaggagatcatccaggcgctgcagaaagaaacg
gagatgaagtcgtgggctgagaagaccctggaaaccctgtcggcgcggtcacctacctcg
ctcaaggttgccctgcgccagctgcgtgttggccggcagtggaccatttccgagaccttc
cagcgtgagcacgccatcgcatccaagttcatgagacaccccgactttgtggagggcgtg
aaggcccgtctcatgtcgaagcctccccgccaagccacctggcagccggcgaccctcgag
gaggtctcgaccgaggctatcgatcagttcttcgagattcccgagtctgcatcggggcct
gaatctcgactgagtctctaccactacaaatccccgtacacccaatacccctacaagttc
ggattgcctagcgaaagcagaatcgaggctttcgtgcgtcaccgtggaagaaagggagac
ctgaccctcaaagagattgtttcgaacttcgacagcaaagagggtgtgaaggagaaggtc
gccgaagttctggccagacggactgtccgggacgaggctggtcttcactgggtgaactga

DBGET integrated database retrieval system