KEGG   Aspergillus niger: ANI_1_1620094Help
Entry
ANI_1_1620094     CDS       T01030                                 

Gene name
An11g00990
Definition
sphingosine N-acyltransferase lac1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ang  Aspergillus niger
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ANI_1_1620094 (An11g00990)
Enzymes [BR:ang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     ANI_1_1620094 (An11g00990)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 442 aa AA seqDB search
MARVRRRSSNLGADIRGDTTAPAMSTMNEVSPIEPEAPKWDKALQNQSADKLSKPHTKRR
KKSPLRRFKDVCLKHTWLLPLLMLIVLLSLYAINPTESNPMHSAIFLSYPLPPKVPGGPI
MYGKGPKDITFVSFYTIVLSFTREFLMQRLIRPFAVYCGIRGRGKTARFMEQVYTAIYFA
IFGPFGLYVMSRSDIWYFNTTAMFEGFPHREHEGLFKAFYLLEASYWAQQAIVLMLQLEK
PRKDFKELVGHHIITLALIGLSYRFHFTYMGIAVYITHDISDFFLATSKTLNYLDHIITV
PYFGMFVGMWIYLRHYLNLKILWAVLTEFRTVGPFELNWETQQYKCWISQYITFALLASL
QAVNLFWLFLILRILKNYIFNSIKKDERSEDEDSEEEEVPVPDTDTHATLATGVEGATVT
ARGKENQTPQVLVNGKPVNSKN
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgtacggagaaggtcgagtaacctgggggcggacattcggggagacaccacc
gctcccgccatgtccaccatgaacgaagtcagccccattgaacccgaggctcctaaatgg
gacaaggccttgcagaatcaatccgccgataaactctccaagccgcatacgaagcgccgc
aagaagtccccgctccgtcgcttcaaggatgtgtgtctcaagcatacttggcttttgcct
ctcctcatgctcatcgttcttctgtcgctgtacgcgatcaacccgacggaatccaatccc
atgcatagcgccatctttttgtcttatcctctgcctccaaaggtccccggtggtccgatc
atgtatggaaagggccccaaggatattacctttgtctcattctacacgattgttctgtcg
tttactcgagaattcctgatgcagcgccttattcggcctttcgctgtatactgcgggatc
cgaggccggggcaagactgcccgtttcatggagcaggtgtacaccgcgatctactttgcc
atcttcggtccattcggcctgtacgtcatgagccggtcggatatctggtacttcaacact
acggccatgttcgaagggttcccccaccgggagcacgaagggttgttcaaggcattctat
ctgcttgaggctagttactgggctcagcaggcgattgtcctgatgttgcagttggagaag
ccgcgcaaggatttcaaggagctggttggacaccacatcatcactctggctctgatcgga
ttgagttatcgcttccacttcacctacatgggtatcgccgtctacatcacgcacgacatc
tctgacttcttccttgctacctccaagaccttgaactacctcgaccacatcatcactgtc
ccttactttggtatgtttgtgggcatgtggatctaccttcgccactatctgaatcttaag
atcctctgggctgtgttgaccgagttccgcacggtcggaccttttgagctgaactgggag
actcaacagtacaagtgctggatcagtcagtacatcacttttgccctgttggccagtctg
caagccgtgaacctcttctggctcttcctgatcctgcgcatcctgaagaactacattttc
aacagcatcaagaaggacgagagaagcgaagatgaagactcggaggaagaggaagtccct
gtgccggacacggacacccacgcgacccttgcgaccggcgtcgagggagccaccgtgact
gcacgtggcaaggagaaccagactccgcaggtgctggtcaacggcaagcccgtcaactcc
aagaactga

DBGET integrated database retrieval system