KEGG   Aspergillus niger: ANI_1_166054Help
Entry
ANI_1_166054      CDS       T01030                                 

Gene name
An06g01380
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ANI_1_166054 (An06g01380)
Peptidases [BR:ang01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ANI_1_166054 (An06g01380)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1266 aa AA seqDB search
MSSPLKPGKTAPRLVQDIHDYDPVHPPGSGRNLLSEVPPVFPDHYIGPSEFISPSACRHT
YVIKSKQSFLPKPEQRSSSGNPTKVSAICSKCRYHLQLVVTSTPGIGSQSLPGHIHHLVY
KSGRQRGGASAEEITPKGQVAETFHYDCSYLTCPAAVSVRIVSPVLHPEWVQLLTDPELL
QQRADEAIQTHPERLEGIARPQPINVLENLHAYISNAFNPSQQNKSISAINKRFITCFGV
EGKPCKDLLEFLGFSVKNEGFWEPPRPNAWAEIPYQDQLKIFLDDVLHELAVLIEQRPVL
EKKGHQVDFSNKIARDDLLNALEALDYQKALNVDTFEMPPAPYYEDLGVVEDMSAQLIIE
AFNRQVAVDPGRMPTYLKCLKAIGSLRGGYEADAIDQAVQVAYADGKYTDDDVINAYKYF
GLTHDDPRLTEDSIIGTFHAYLSSTTQETDSRRELWKIGDSRRSERIKSAAEDRVATVEQ
AQVYLGVSEETSDDFIMAMYTAKVNDTPSSRDLARRAVEFIAEARKSDALRHFVRTGEMT
AGEMDIGDAYRLLQIPDRTVDEAAIMAAYTICVDEAPGQAETYNQALRIIAKDKNSTLLS
SMVSGDDTKPDRNMSDWPVGLQNIGNTCYLNSLLQFYFSVRPYREMVLDFESFKMELTDE
SLSKKQVGSRKVSKKEVERSQRFLRELRTLFSDMITSPSSHVTPGRELARLTLISPSNEA
AIRRRSTISAYRPAGALGEINGMPVLGPLGPPQPIPEKQVENETENQAVTESEVIKRSTV
SDVDSEATLVSDGVKNDIKAPPVDDKENEPPADLDLNDVQNEPSSDSADIGSPGDTTPID
NVEPSNRPPPVPPRPTPQVDPQKQLIEEVEIGAQQDVTEVINNVLFQSQCAIRPIAHSPE
GEQIDQVKDLFYGRTRSYIASEKGVRSKEEWWCDIKIDVATGPRDIYAAIDGAFDVQKVN
VENSVAEQYGAISKLPPVLQIQVQRVQFDPTTKRSFKSTHHLGLKETIYLDRYMDSQQPQ
FLDRRQQCWQWKNSLRELEVRRAELLRQVDSDGMDTAGLLNSAKEVLEDLAAMREEPDYA
EDAIDFDTQIITEVDQLSQIAKADLNYVENQIQETQDKISAQFADYKYLAYRLYAVFVHH
GSVSFGHYYIYIFDFERNVWRKYNDNYVTEVNNLDEIFKDEGQPNPPTPYFLVYVNDAMK
DRLANPVCREILEASTANTNEDMDMNPPAYDEIWTDQSGSGAEVKPPVRDSTMNPLKRKG
LGDEGG
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctccgctgaagcctggcaagactgccccacgtcttgtgcaagatatccacgac
tatgaccctgtccatcctccaggctccggccgcaacctgctgtcggaggtccccccggtc
ttccccgatcactatattggaccatcagagttcatatcgccttcagcatgccgtcatact
tatgtgatcaagtcgaaacagagcttcctaccaaaaccagagcagagaagcagctcaggc
aaccccaccaaagtatcagcgatatgctccaagtgccgataccatctacagctggtcgtg
acatcgacacctgggatcggcagccagagtttgccgggacacatacaccatctggtttat
aagtcagggaggcagagaggaggtgcatcggcagaagaaatcacacccaagggccaggtg
gcggagacattccattatgactgctcctacctcacttgtccagcggcagtgtccgtcaga
attgtctctcctgtgctccatccagaatgggtacaactcttgacagatcctgagttgctg
cagcagcgagcagatgaggcgattcaaacacaccccgagcgcctggaagggatagcccgg
ccgcagcccatcaatgtcttggaaaacttgcacgcatatatcagcaatgcctttaatccc
agtcaacagaataaatctatatcagcgattaacaagaggttcataacgtgcttcggtgtt
gaagggaagccttgcaaagacctgttagaatttttggggttctccgtcaagaatgaaggt
ttttgggagcccccgcgccccaacgcctgggcggaaatcccctaccaggatcaactcaaa
atcttcctcgatgatgttctacatgagcttgctgtactcatcgagcagcggccagtgctt
gagaagaaaggccatcaggtggatttctcaaacaagatagcaagggatgacctcttgaat
gctctggaagcattagactaccagaaggctctcaatgtcgacacatttgaaatgccccct
gctccttactatgaagatctgggcgtcgtggaagatatgtctgcgcaattgattattgag
gcgttcaatcgccaggtcgccgtagaccctggtcgcatgcctacatacctgaaatgcctc
aaggcgataggtagccttagagggggctacgaagctgacgccattgatcaagcagttcag
gtggcttatgccgacggcaagtacactgatgacgacgtcatcaatgcttacaagtacttc
ggtttaacacacgacgacccgcggcttactgaggacagcatcattgggaccttccatgct
tacttgagctccaccactcaggagacagactcacgcagagaactgtggaagataggcgac
agcaggcgtagtgagcgcattaagtcagcggctgaagatagagtggcaactgttgagcaa
gcccaagtttaccttggcgtcagcgaggaaacaagcgacgactttattatggccatgtat
acagctaaggtcaatgacactccatcgagcagggatctcgcgcgccgcgccgttgaattc
attgcggaggcgcggaaatcggatgctcttcgacacttcgtcaggactggcgagatgacg
gccggtgagatggatatcggggatgcctaccggcttcttcaaatccccgatcgtacggtt
gatgaagcagcaatcatggcagcttatacgatttgcgtcgacgaagctccgggacaggct
gaaacgtacaaccaagccttgcgtataattgctaaagacaagaatagcactctgctaagc
agtatggtctctggtgatgatacaaagccggaccgtaatatgtcggattggcctgttgga
ttgcagaacattggcaacacatgctatctcaatagtctactacaattctatttctctgtg
cgcccgtacagggagatggtcttggattttgagagcttcaagatggagttgactgatgag
agcctgagcaagaaacaggtgggatctcgcaaggtttccaagaaggaggtggaacgttca
caaaggtttctcagagaattacggacgctcttttccgacatgattacttccccatcctct
catgtcacgccgggccgggagttggcgcggttgacattgatcagtccttccaacgaagca
gcgatacgtcgtcggtctacaatctccgcgtacaggcccgccggtgccttaggtgaaatc
aacggcatgccggtactaggacctcttgggccgccgcaaccgattccggagaagcaagta
gagaatgagacggagaaccaggcggttaccgaaagcgaggtgattaagcgctcaacagtt
agcgatgtcgatagcgaggccacacttgtctctgatggtgtcaagaatgacatcaaagct
cccccggttgacgataaagagaacgagccaccggctgatctggacctgaatgacgtgcag
aatgagccaagttctgattccgctgacatagggtcccccggcgatacaacacccatagac
aatgtcgaaccttccaatcgaccaccgccagtgcctccgcggcccaccccgcaagttgac
ccccagaagcagcttatagaagaggtagagatcggagcgcagcaggatgtgacggaagtc
atcaacaacgtgcttttccaaagccaatgtgcgattcggcccattgctcattctccggag
ggtgagcaaattgatcaagtgaaagatcttttttacggccgaacccgatcttatattgcc
tcagaaaaaggcgtccggtcgaaagaagagtggtggtgtgacatcaaaatcgatgttgca
actggcccgcgcgacatttatgcagccattgacggtgcctttgacgtacagaaggtgaat
gtggagaactcggtggctgagcagtatggtgctatcagcaagctcccgccagtgcttcag
atccaggttcagcgtgtccagtttgaccccacgacgaagcgctcttttaaatccactcac
catcttggattgaaggagacgatttatctcgaccgatacatggactcgcaacaaccccag
ttcctggaccggcgacagcagtgctggcaatggaaaaattcgctcagagagctcgaggtg
cgccgcgcggagttactgcgccaagtggattccgacggcatggatacggcgggattactc
aacagcgctaaggaagtactcgaagatttggcagctatgagagaagagcccgattatgca
gaggacgcgattgactttgacacgcaaataatcaccgaggttgatcagctttctcaaatc
gcaaaggctgacttgaactatgtcgaaaaccaaatccaggagacccaggacaagatctcc
gctcagttcgccgactacaagtacctcgcctatcgcctgtatgccgtgttcgtccaccac
gggtccgtttccttcggccattactacatttacatcttcgacttcgaacggaacgtctgg
agaaaatacaatgacaactatgtcaccgaagtaaacaacctggacgagatcttcaaggac
gagggacagcccaacccgcccacgccatacttcctggtatacgtcaacgacgcgatgaag
gatcggctcgccaacccggtctgcagggaaatcttggaagcttccacggcgaataccaat
gaagatatggacatgaatccaccagcgtacgacgagatctggacggaccagagcggatca
ggcgcagaggtcaagccgccggtccgagactcgacaatgaacccccttaaacgcaagggc
ctgggcgatgaaggaggctga

DBGET integrated database retrieval system