KEGG   Aspergillus niger: ANI_1_1706134Help
Entry
ANI_1_1706134     CDS       T01030                                 

Gene name
An15g06810
Definition
NADH-cytochrome B5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ang  Aspergillus niger
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ang00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 293 aa AA seqDB search
MNTLQRTFPRAIKVAGVAGFAGLGIYYTKLYSTAFAESNEPKTVFSGLGLTTLRLQSIRT
VNHNTKRLVFEYPDESASSGLTLTSALLAITHPEGSWLPTIRPYTPISDLDEPGHIELMV
KKYPDGKASGYLHSLKPGDSLRFATSLKGYQWKPNEFSHAYLLAGGAGITPIYQLIKGTL
KNPHDRTKLTLVFGVNSEEDLLLKEELDRYATEFPDRFNYIYTVSRPKKETSPYRTGYID
EELLKSVFKGSTQGTKVFICGPPAMEDALAGTRRSPEGILSRLGFSKDQVHKF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaatactctccagcgcacatttcccagggcgatcaaggttgctggagtggctggcttt
gcaggcctgggcatatattacacgaagctgtattcaacggcatttgcggaatcgaatgag
ccaaagacggtcttctctgggctaggactcaccactttgcgcttgcagagcatcagaacc
gttaatcacaacacgaagcgactggtcttcgaataccctgacgaatccgccagcagcggc
ctgacattgacttctgcactactagcaatcacacatcctgaagggagctggcttcccacg
attcgaccatatacacctataagtgacttagacgaaccaggccatattgaacttatggtc
aagaaatacccagacgggaaggccagcggttacttgcactccttgaaaccaggagactca
cttaggtttgcgacttcattgaaaggatatcagtggaagccgaatgagttctcccacgcc
tatctcttggctggcggggctggaattacgccaatttatcagcttataaaaggcaccctg
aaaaatcctcatgatagaacgaagctgactcttgtattcggcgtcaactccgaggaagat
ttactgttgaaggaggaacttgatcgctatgccacagagttccctgaccgcttcaactac
atttacactgtcagccgtccaaaaaaggagacatctccttatagaacaggatacattgac
gaagaacttttaaagagcgtttttaagggttcgacacagggtacaaaggtattcatttgc
ggtcctccggcgatggaagatgccctggctggaacaagaagatctcctgaggggatcctg
agtcgattgggtttctcgaaggatcaggttcacaaattttag

DBGET integrated database retrieval system