KEGG   Aspergillus niger: ANI_1_1724104Help
Entry
ANI_1_1724104     CDS       T01030                                 

Gene name
An12g04020
Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
ang  Aspergillus niger
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ANI_1_1724104 (An12g04020)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ANI_1_1724104 (An12g04020)
   00640 Propanoate metabolism
    ANI_1_1724104 (An12g04020)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ANI_1_1724104 (An12g04020)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    ANI_1_1724104 (An12g04020)
Enzymes [BR:ang01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ANI_1_1724104 (An12g04020)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ANI_1_1724104 (An12g04020)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2283 aa AA seqDB search
MSAPNGHPSARAAQHNLASHFIGGNNLNAAPPSSVKDFVASHEGHSVISSVLIANNGIAA
VKEIRSVRKWAYETFGNERAIQFTVMATPEDLHANADYIRMADQYVEVPGGTNNNNYANV
DLIVDVAERMDVHAVWAGWGHASENPRLPEALAASPKRIIFIGPPASAMRSLGDKISSTI
VAQHAGVPCIPWSGTGVDDVRIDDKGIVTVDDDVYNRGCTFSPEEGLEKAKEIGFPVMIK
ASEGGGGKGIRKVEREEDFISLYNAAANEIPGSPIFIMKLAGNARHLEVQLLADQYGNNI
SLFGRDCSVQRRHQKIIEEAPVTIAKPITFQAMERAAVSLGRLVGYVSAGTVEYLYSHAD
DKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPNTSGEI
DFDFSNEESFQTQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFSV
GTAGGIHSFSDSQFGHIFAYGENRSASRKHMVIALKELSIRGDFRTTVEYLIKLLETPAF
EDNTITTGWLDQLISNKLTAERPDTIVAVLCGAVTKAHQASEAGVEEYRKGLEKGQVPSK
DVLKTVFPVDFIYEGQRYKFTATRASLDSYHLFINGSRCSVGVRALADGGLLVLLNGRSH
NVYWKEEPAATRLSVDGKTCLLEQENDPTQLRTPSPGKLVKFTVENGEHVKAGQPFAEVE
VMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVKHAQPFTGQLPELGPPQ
VVGSKPPQRFFLLHSILENILKGYDNQVIMNATLKELVEVLRNPDLPYGEWNAQSSALHS
RMPQKLDSQLQNIVDKARARKAEFPAKQLQKTVQRFIEENVNPADAEILKTTLLPLTEVI
NKYLDGLKVHEFNVFIGLLEQYYEVEKLFAGRNLRDEDSILKLRDENKEDIGKVVQTVLS
HSRIGAKNNLILAILAMYRPNQPNVGNVSKYFKPILKKLTEFESRAAAKVTLKARELLIQ
CALPSLEERLSQMELILRSSVVESSYGETGWEHREPDSQVLKEVVDSKYTVFDVLPRFFV
HQDVWVTLAALEVYVRRAYRAYTVKGIQYSASGEVPILSWDFTLDKLGQPEFGPVTTDPS
TPSTPTAEMNPFKRINSISDMSYLVGDGSEPMRKGAIIPVQYLEDAEEFLPRALEIFPRA
GSKKKASDNGLLANLEGKRRPAPRVENENELTGVLNVAIRDVEDLDDNQIVSQINNMLAD
LKEELLARRIRRVTFICGKNGIYPGYFTFRGPNYDEDESIRHNEPALAFQLELGRLSKFK
IKPVFTENRNIHVYEAIGKGPENDKAVDKRYFVRAVVRPGRLRDDIPTAEYLTSEADRLM
NDILDALEIIGNNNSDLNHIFINFSPVFNLQPKDVEEALAGFLERFGRRLWRLRVTGAEI
RILCTDPVTGVPYPLRVIITNTYGFIIQVELYIEKKTEKGEWIFHSIDGGSNKLGSMHLR
PVSTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNSWTKAIANIPSLADQRPPVG
ECIDYSELVLDDTDNLVEISRGPGTNTHGMVGWIVTARTPEYPRGRRFIIVANDITFQIG
SFGPAEDKFFHKCTELARKLGIPRIYLSANSGARIGMADELIPYFSVAWNDPENPAAGFK
YLYFTPEVKQKLDASKKKEVITEEIQDEGEVRHKITTVIGAKDGLGVECLKGSGLIAGAT
SKAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYTSNL
QLGGTQIMYRNGVSHMTANDDFEGVQKIVEWMSFVPDRKGAPIPIRPWSDTWDRDVAYYP
PAKQPYDPRWLIAGKEDEEGFLPGLFDTGSFEEALGGWARTVVVGRARLGGIPMGVIAVE
TRSVENVTPADPANPDSMEMVANEAGGVWYPNSAYKTAQALRDFNNGEQLPVMILANWRG
FSGGQRDMYNEVLKYGSYIVDALVKYEQPIFIYIPPHGELRGGSWVVVDPTINPDQMEMY
ADVEARGGVLEPEGIVNIKYRRDKQLDTMARLDATYGELRRSLEDPSLSKEQLSDVKAKM
AAREEQLLPVYLQIALQFADLHDRAGRMEAKNTIRHPLTWKNARRFFYWRLRRRLSEELI
VKRMVAAAPNPAARDGSVAIPAGSNAPVSTESARAVHLRTLHGWTGLLDDELQREDQRVA
TWYEENKKAIQTKVDSLKAESVATEVAQLLVNNRDGALKGVQQILSVLPVEEKEAVLKYL
SSN
NT seq 6852 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcccaacggccaccccagtgcgcgtgccgcgcaacacaacctcgcttcacat
ttcattggtggtaacaacctgaatgccgcaccgcccagcagcgtcaaggacttcgtggcc
agccatgagggtcactccgttatcagctcggttctgatcgccaacaacggtattgccgcc
gtcaaggagattcgttccgtccggaaatgggcttatgaaactttcggcaatgagcgtgcc
atccagttcacagtgatggccacgccagaagatctgcacgccaatgccgactacatccgt
atggcagatcaatatgttgaggttcccggaggcacgaataacaacaactacgccaacgtc
gatctgatcgtcgatgtcgctgaacgtatggacgtccacgccgtgtgggccggttggggt
cacgcctctgagaacccccgtttacccgaagctctggctgcttcccccaagagaatcatc
ttcattggtccccccgcctctgccatgcgctcgcttggtgacaagatctcctccacaatc
gtcgctcagcatgccggtgtcccttgtattccctggtctggaacgggtgtggatgatgtc
cggatcgacgacaagggtattgtgaccgttgatgacgacgtctacaaccggggttgcaca
ttctcgcccgaggagggtctggagaaggccaaggagattggattcccggtcatgatcaag
gcctccgaaggtggtggtggtaagggtattcgtaaggttgagcgggaggaggatttcatc
agcctgtacaacgccgctgccaacgaaatccctggttcccccatcttcatcatgaagctc
gccggtaacgcccgccacttggaagtccagctgctggccgatcagtacggtaacaacatc
tccctcttcggtcgtgattgttccgtgcagcgtcgtcaccagaagattatcgaagaggcg
cccgtcacgatcgccaagcccatcactttccaggccatggagcgcgccgccgtgagcctt
ggtcggttggtcggctacgtctcggctggtaccgtggaatatctgtactcccacgctgac
gacaagttctacttcttggaactgaacccccgtctgcaggtcgagcacccgaccactgag
atggtttccggagtcaacctgccggctgcccagctccagattgccatgggtatccctctg
caccgcattcgcgacatccgtctgctgtacggcgtggaccccaacacctccggtgagatc
gacttcgatttctccaacgaggagagtttccagacccagcgccgcccgcagcccaaggga
cacaccaccgcttgccgtatcacttctgaagatcccggcgagggtttcaagccttccagc
ggtaccatgcacgaattgaacttccgcagttcctccaacgtctggggttatttctccgtc
ggtacggctggtggtatccacagcttctccgacagtcagttcggtcacatcttcgcctac
ggtgagaaccgttccgcatctcggaagcacatggtcattgccctgaaggaattgagcatt
cgtggtgatttccgtaccactgtggagtacctgatcaagcttcttgagaccccggccttc
gaagacaacacgatcaccaccggctggttggatcagctgatctccaacaagctgaccgct
gagcgtcctgacacgatcgtcgctgtcctgtgtggagctgttaccaaggcccaccaggct
agcgaggctggtgttgaggaataccgcaagggattggagaagggtcaggtaccctccaag
gacgtcttgaagacggtcttccctgtggacttcatctatgaaggccagcggtacaagttc
accgccacccgcgccagccttgacagctaccacctcttcatcaacggttccaggtgctcc
gtgggcgtgcgtgctctggctgacggtggtctgttggtcctcctgaacggccgcagtcac
aacgtctactggaaggaggagcctgctgccactcgtctgagtgtcgatggcaagacttgc
cttctcgagcaggagaacgaccccacccagctgcgtaccccctctcctggtaagctggtc
aagttcaccgtcgagaacggtgagcacgtcaaggcgggccagcccttcgctgaagtcgag
gtcatgaagatgtacatgcccctgatcgcccaggaagacggtattgtccagcttatcaag
cagcccggagctaccctggaggccggtgacatccttggtatcctcgctttggatgacccg
tcccgcgtgaagcacgcccagcccttcactggtcagcttcccgagcttggccctcctcag
gttgtgggtagcaagcctcctcagaggttcttcctcttgcacagcatccttgagaacatc
ttgaagggatacgacaaccaggtcatcatgaacgccaccctcaaggagctggtcgaggtc
ctccgtaaccccgatcttccttacggcgagtggaacgcccagtcctccgctctgcactct
cgcatgccccagaagctcgacagccagctccagaacatcgtcgacaaagcccgcgcccgt
aaggctgagttccctgccaagcagctccagaagaccgtgcagcgtttcatcgaggagaat
gtcaaccccgccgatgctgagatcctcaagaccacgcttcttcctctcaccgaagtcatc
aacaagtaccttgatggcctcaaggtccacgagttcaatgtcttcattggtctcctggaa
cagtactacgaggtggagaagctcttcgctggccgcaacctccgcgatgaagactctatc
ctgaagctccgtgacgagaacaaggaggacattggcaaggtggtccagaccgtcctgtct
cacagccgcattggtgccaagaacaacctcatcctcgctattctggccatgtaccgcccc
aaccagcccaatgtcggcaatgtctccaagtacttcaagcccatcctgaagaagttgact
gagtttgagtctcgcgctgctgccaaggtcactctcaaggcccgtgagcttctgatccag
tgtgctctcccatccttggaggagcgcctgtctcagatggaactcatcctgcgttcgtcg
gttgtcgagtccagctatggcgagaccggctgggagcaccgtgagcccgattcccaggtt
cttaaggaggtggtggactccaagtacaccgtcttcgatgtgctgccgcgcttcttcgtt
caccaggatgtctgggttactctggctgctcttgaggtctacgtgcgccgcgcttaccgt
gcctacactgtcaagggtattcagtactctgcttctggagaggttcctatcctctcctgg
gacttcactctcgacaagctgggacagcccgagttcggccctgtcaccactgacccgtcg
acccccagcacccctaccgctgagatgaaccccttcaagcggatcaactccatcagtgac
atgtcgtacctggttggcgacggtagcgagcccatgagaaagggtgccatcatccctgtt
cagtacctggaggatgctgaggagttcctgcccagagccctcgagatcttccccagagct
ggctcgaagaagaaggccagtgataacggtctgctcgccaacctggagggcaagcgccgc
cctgctcctcgggttgagaacgagaatgagctgactggtgtcctcaacgtcgccatccgt
gatgtggaggatctggacgacaaccagatcgtctcccagatcaacaacatgctggccgac
ctcaaggaagaactgcttgctcgtcgcatccgtcgtgtcaccttcatctgtggcaagaac
ggtatctaccccggctacttcactttccgtggccccaactacgatgaggatgagagtatc
cgtcacaacgagcctgcccttgccttccagctggagctcggccgtttgtccaagttcaag
atcaagcccgtcttcactgagaaccggaacatccacgtctacgaggccatcggaaagggc
cccgagaacgacaaggctgtggacaagcgctacttcgttcgtgccgtcgtgcgccccggt
cgcctgcgcgatgatatccccaccgcggagtacctgacctcggaggctgaccgtctcatg
aacgacattctggacgccctggagatcatcggcaacaacaactccgacttgaaccacatc
ttcatcaacttctcgcctgtcttcaacctgcagcctaaggatgttgaagaggctctggcc
ggtttcttggagcgctttggccgtcgtctctggagactccgtgttaccggtgctgagatt
cgcatcctgtgcaccgaccccgtcactggtgttccctaccctctgcgtgtcatcatcacc
aacacctatggattcatcatccaggttgagctgtacattgagaagaagaccgagaagggc
gagtggatcttccacagcattgatggtggcagcaacaagctgggttccatgcacttgcgt
cctgtctccactccttacccgactaaggaatggctgcagcccaagcgctacaaggcccac
ctcatgggtactcagtacgtctatgacttccctgagctcttcagacaagccttccagaac
agctggaccaaggccattgccaacatcccctccttggccgaccagcgccctcccgttggc
gagtgcatcgactacagcgagcttgtccttgatgacaccgacaacctggtcgagatttcc
cgcggccctggcaccaacacccatggtatggttggttggatcgtcactgcccgtaccccc
gagtacccccgtggtagacgcttcatcattgttgccaacgacatcaccttccagattggt
tctttcggtcccgctgaagacaaattcttccacaagtgcactgaacttgctcgcaagctg
ggtatccctcgtatctacctttctgccaactccggtgctcgtatcggcatggctgacgag
ttgatcccttacttctccgtcgcctggaacgaccccgagaaccccgccgccggtttcaag
tacctgtacttcaccccggaggtcaagcagaagctggatgccagcaagaagaaggaagtc
atcactgaggagatccaagatgagggtgaagtgcgccacaagatcaccaccgtcatcggt
gctaaggacggtctgggtgtcgagtgtctcaagggttccggtctgattgccggtgctacc
tccaaggcttacgaggacatcttcaccatcaccctcgttacttgccgttccgttggtatt
ggtgcctaccttgtccgtcttggacagagagctatccaggtcgagggccagccgatcatt
ctcactggtgcccccgctatcaacaagctgttgggtagagaagtgtacacttccaacttg
cagcttggtggcacccagatcatgtaccgcaacggtgtgtcccacatgactgccaacgat
gacttcgagggtgtgcagaagattgtcgagtggatgtctttcgtccccgacaggaagggt
gcccccatccctatccgcccctggtccgacacttgggaccgcgatgtcgcctactaccct
cccgccaagcagccctacgatcctcgctggctcattgccggtaaggaagacgaggaaggt
ttcctgcctggattgttcgatactggctctttcgaggaggctcttggtggctgggctcgc
accgtcgttgttggtcgtgccagactcggcggcattcccatgggtgtgattgctgttgag
actcgctccgttgagaacgtcactcctgccgaccctgccaaccccgactctatggagatg
gttgccaacgaagctggtggtgtctggtaccccaactccgcctacaagaccgcccaggcc
ctccgtgacttcaacaacggtgagcagcttcctgtcatgatcctggctaactggagaggt
ttctccggtggtcagcgtgacatgtacaacgaggtcctcaagtacggttcttacatcgtc
gatgccctcgtcaagtacgagcagcccatcttcatctacatcccgccccatggtgagctt
cgtggtggatcctgggtcgtcgtcgatcccaccatcaaccccgaccagatggagatgtat
gccgatgtggaagctcgtggtggtgtcctcgagcccgagggtatcgtcaacatcaagtac
cgtcgcgacaagcagctcgacaccatggctcgtctggatgccacctatggcgagctccgc
cgctctctcgaggacccgtccctcagcaaggagcagctctctgatgtcaaggccaagatg
gctgcccgcgaggagcagctcctgcccgtctacctgcagattgctctgcagttcgctgat
ctccacgaccgtgctggccgcatggaggccaagaacaccatccgccatcctctcacctgg
aagaacgcccgtcgcttcttctactggcgtctgcgccgcagactcagcgaggagctcatc
gtcaagcgcatggttgctgccgctcccaaccctgctgctcgcgacggctctgttgctatc
cctgctggttccaacgcccctgtctcgaccgagtccgctcgtgctgtgcacctccgcact
ctccacggctggaccggcctgcttgacgacgaactgcagcgcgaggaccagcgcgtcgct
acctggtacgaggagaacaagaaggccatccagaccaaggtggactccctcaaggccgag
agcgtggccacagaagttgcgcagctgctcgtcaacaaccgcgacggtgctctgaagggt
gtgcagcagatcctcagtgtcctccctgtggaggagaaggaggctgttctcaagtacctc
tcttccaactaa

DBGET integrated database retrieval system