KEGG   Aspergillus niger: ANI_1_1724104Help
Entry
ANI_1_1724104     CDS       T01030                                 

Gene name
An12g04020
Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
ang  Aspergillus niger
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ANI_1_1724104 (An12g04020)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ANI_1_1724104 (An12g04020)
   00640 Propanoate metabolism
    ANI_1_1724104 (An12g04020)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ANI_1_1724104 (An12g04020)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    ANI_1_1724104 (An12g04020)
Enzymes [BR:ang01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ANI_1_1724104 (An12g04020)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ANI_1_1724104 (An12g04020)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2283 aa AA seqDB search
MSAPNGHPSARAAQHNLASHFIGGNNLNAAPPSSVKDFVASHEGHSVISSVLIANNGIAA
VKEIRSVRKWAYETFGNERAIQFTVMATPEDLHANADYIRMADQYVEVPGGTNNNNYANV
DLIVDVAERMDVHAVWAGWGHASENPRLPEALAASPKRIIFIGPPASAMRSLGDKISSTI
VAQHAGVPCIPWSGTGVDDVRIDDKGIVTVDDDVYNRGCTFSPEEGLEKAKEIGFPVMIK
ASEGGGGKGIRKVEREEDFISLYNAAANEIPGSPIFIMKLAGNARHLEVQLLADQYGNNI
SLFGRDCSVQRRHQKIIEEAPVTIAKPITFQAMERAAVSLGRLVGYVSAGTVEYLYSHAD
DKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPNTSGEI
DFDFSNEESFQTQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFSV
GTAGGIHSFSDSQFGHIFAYGENRSASRKHMVIALKELSIRGDFRTTVEYLIKLLETPAF
EDNTITTGWLDQLISNKLTAERPDTIVAVLCGAVTKAHQASEAGVEEYRKGLEKGQVPSK
DVLKTVFPVDFIYEGQRYKFTATRASLDSYHLFINGSRCSVGVRALADGGLLVLLNGRSH
NVYWKEEPAATRLSVDGKTCLLEQENDPTQLRTPSPGKLVKFTVENGEHVKAGQPFAEVE
VMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVKHAQPFTGQLPELGPPQ
VVGSKPPQRFFLLHSILENILKGYDNQVIMNATLKELVEVLRNPDLPYGEWNAQSSALHS
RMPQKLDSQLQNIVDKARARKAEFPAKQLQKTVQRFIEENVNPADAEILKTTLLPLTEVI
NKYLDGLKVHEFNVFIGLLEQYYEVEKLFAGRNLRDEDSILKLRDENKEDIGKVVQTVLS
HSRIGAKNNLILAILAMYRPNQPNVGNVSKYFKPILKKLTEFESRAAAKVTLKARELLIQ
CALPSLEERLSQMELILRSSVVESSYGETGWEHREPDSQVLKEVVDSKYTVFDVLPRFFV
HQDVWVTLAALEVYVRRAYRAYTVKGIQYSASGEVPILSWDFTLDKLGQPEFGPVTTDPS
TPSTPTAEMNPFKRINSISDMSYLVGDGSEPMRKGAIIPVQYLEDAEEFLPRALEIFPRA
GSKKKASDNGLLANLEGKRRPAPRVENENELTGVLNVAIRDVEDLDDNQIVSQINNMLAD
LKEELLARRIRRVTFICGKNGIYPGYFTFRGPNYDEDESIRHNEPALAFQLELGRLSKFK
IKPVFTENRNIHVYEAIGKGPENDKAVDKRYFVRAVVRPGRLRDDIPTAEYLTSEADRLM
NDILDALEIIGNNNSDLNHIFINFSPVFNLQPKDVEEALAGFLERFGRRLWRLRVTGAEI
RILCTDPVTGVPYPLRVIITNTYGFIIQVELYIEKKTEKGEWIFHSIDGGSNKLGSMHLR
PVSTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNSWTKAIANIPSLADQRPPVG
ECIDYSELVLDDTDNLVEISRGPGTNTHGMVGWIVTARTPEYPRGRRFIIVANDITFQIG
SFGPAEDKFFHKCTELARKLGIPRIYLSANSGARIGMADELIPYFSVAWNDPENPAAGFK
YLYFTPEVKQKLDASKKKEVITEEIQDEGEVRHKITTVIGAKDGLGVECLKGSGLIAGAT
SKAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYTSNL
QLGGTQIMYRNGVSHMTANDDFEGVQKIVEWMSFVPDRKGAPIPIRPWSDTWDRDVAYYP
PAKQPYDPRWLIAGKEDEEGFLPGLFDTGSFEEALGGWARTVVVGRARLGGIPMGVIAVE
TRSVENVTPADPANPDSMEMVANEAGGVWYPNSAYKTAQALRDFNNGEQLPVMILANWRG
FSGGQRDMYNEVLKYGSYIVDALVKYEQPIFIYIPPHGELRGGSWVVVDPTINPDQMEMY
ADVEARGGVLEPEGIVNIKYRRDKQLDTMARLDATYGELRRSLEDPSLSKEQLSDVKAKM
AAREEQLLPVYLQIALQFADLHDRAGRMEAKNTIRHPLTWKNARRFFYWRLRRRLSEELI
VKRMVAAAPNPAARDGSVAIPAGSNAPVSTESARAVHLRTLHGWTGLLDDELQREDQRVA
TWYEENKKAIQTKVDSLKAESVATEVAQLLVNNRDGALKGVQQILSVLPVEEKEAVLKYL
SSN
NT seq 6852 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcccaacggccaccccagtgcgcgtgccgcgcaacacaacctcgcttcacat
ttcattggtggtaacaacctgaatgccgcaccgcccagcagcgtcaaggacttcgtggcc
agccatgagggtcactccgttatcagctcggttctgatcgccaacaacggtattgccgcc
gtcaaggagattcgttccgtccggaaatgggcttatgaaactttcggcaatgagcgtgcc
atccagttcacagtgatggccacgccagaagatctgcacgccaatgccgactacatccgt
atggcagatcaatatgttgaggttcccggaggcacgaataacaacaactacgccaacgtc
gatctgatcgtcgatgtcgctgaacgtatggacgtccacgccgtgtgggccggttggggt
cacgcctctgagaacccccgtttacccgaagctctggctgcttcccccaagagaatcatc
ttcattggtccccccgcctctgccatgcgctcgcttggtgacaagatctcctccacaatc
gtcgctcagcatgccggtgtcccttgtattccctggtctggaacgggtgtggatgatgtc
cggatcgacgacaagggtattgtgaccgttgatgacgacgtctacaaccggggttgcaca
ttctcgcccgaggagggtctggagaaggccaaggagattggattcccggtcatgatcaag
gcctccgaaggtggtggtggtaagggtattcgtaaggttgagcgggaggaggatttcatc
agcctgtacaacgccgctgccaacgaaatccctggttcccccatcttcatcatgaagctc
gccggtaacgcccgccacttggaagtccagctgctggccgatcagtacggtaacaacatc
tccctcttcggtcgtgattgttccgtgcagcgtcgtcaccagaagattatcgaagaggcg
cccgtcacgatcgccaagcccatcactttccaggccatggagcgcgccgccgtgagcctt
ggtcggttggtcggctacgtctcggctggtaccgtggaatatctgtactcccacgctgac
gacaagttctacttcttggaactgaacccccgtctgcaggtcgagcacccgaccactgag
atggtttccggagtcaacctgccggctgcccagctccagattgccatgggtatccctctg
caccgcattcgcgacatccgtctgctgtacggcgtggaccccaacacctccggtgagatc
gacttcgatttctccaacgaggagagtttccagacccagcgccgcccgcagcccaaggga
cacaccaccgcttgccgtatcacttctgaagatcccggcgagggtttcaagccttccagc
ggtaccatgcacgaattgaacttccgcagttcctccaacgtctggggttatttctccgtc
ggtacggctggtggtatccacagcttctccgacagtcagttcggtcacatcttcgcctac
ggtgagaaccgttccgcatctcggaagcacatggtcattgccctgaaggaattgagcatt
cgtggtgatttccgtaccactgtggagtacctgatcaagcttcttgagaccccggccttc
gaagacaacacgatcaccaccggctggttggatcagctgatctccaacaagctgaccgct
gagcgtcctgacacgatcgtcgctgtcctgtgtggagctgttaccaaggcccaccaggct
agcgaggctggtgttgaggaataccgcaagggattggagaagggtcaggtaccctccaag
gacgtcttgaagacggtcttccctgtggacttcatctatgaaggccagcggtacaagttc
accgccacccgcgccagccttgacagctaccacctcttcatcaacggttccaggtgctcc
gtgggcgtgcgtgctctggctgacggtggtctgttggtcctcctgaacggccgcagtcac
aacgtctactggaaggaggagcctgctgccactcgtctgagtgtcgatggcaagacttgc
cttctcgagcaggagaacgaccccacccagctgcgtaccccctctcctggtaagctggtc
aagttcaccgtcgagaacggtgagcacgtcaaggcgggccagcccttcgctgaagtcgag
gtcatgaagatgtacatgcccctgatcgcccaggaagacggtattgtccagcttatcaag
cagcccggagctaccctggaggccggtgacatccttggtatcctcgctttggatgacccg
tcccgcgtgaagcacgcccagcccttcactggtcagcttcccgagcttggccctcctcag
gttgtgggtagcaagcctcctcagaggttcttcctcttgcacagcatccttgagaacatc
ttgaagggatacgacaaccaggtcatcatgaacgccaccctcaaggagctggtcgaggtc
ctccgtaaccccgatcttccttacggcgagtggaacgcccagtcctccgctctgcactct
cgcatgccccagaagctcgacagccagctccagaacatcgtcgacaaagcccgcgcccgt
aaggctgagttccctgccaagcagctccagaagaccgtgcagcgtttcatcgaggagaat
gtcaaccccgccgatgctgagatcctcaagaccacgcttcttcctctcaccgaagtcatc
aacaagtaccttgatggcctcaaggtccacgagttcaatgtcttcattggtctcctggaa
cagtactacgaggtggagaagctcttcgctggccgcaacctccgcgatgaagactctatc
ctgaagctccgtgacgagaacaaggaggacattggcaaggtggtccagaccgtcctgtct
cacagccgcattggtgccaagaacaacctcatcctcgctattctggccatgtaccgcccc
aaccagcccaatgtcggcaatgtctccaagtacttcaagcccatcctgaagaagttgact
gagtttgagtctcgcgctgctgccaaggtcactctcaaggcccgtgagcttctgatccag
tgtgctctcccatccttggaggagcgcctgtctcagatggaactcatcctgcgttcgtcg
gttgtcgagtccagctatggcgagaccggctgggagcaccgtgagcccgattcccaggtt
cttaaggaggtggtggactccaagtacaccgtcttcgatgtgctgccgcgcttcttcgtt
caccaggatgtctgggttactctggctgctcttgaggtctacgtgcgccgcgcttaccgt
gcctacactgtcaagggtattcagtactctgcttctggagaggttcctatcctctcctgg
gacttcactctcgacaagctgggacagcccgagttcggccctgtcaccactgacccgtcg
acccccagcacccctaccgctgagatgaaccccttcaagcggatcaactccatcagtgac
atgtcgtacctggttggcgacggtagcgagcccatgagaaagggtgccatcatccctgtt
cagtacctggaggatgctgaggagttcctgcccagagccctcgagatcttccccagagct
ggctcgaagaagaaggccagtgataacggtctgctcgccaacctggagggcaagcgccgc
cctgctcctcgggttgagaacgagaatgagctgactggtgtcctcaacgtcgccatccgt
gatgtggaggatctggacgacaaccagatcgtctcccagatcaacaacatgctggccgac
ctcaaggaagaactgcttgctcgtcgcatccgtcgtgtcaccttcatctgtggcaagaac
ggtatctaccccggctacttcactttccgtggccccaactacgatgaggatgagagtatc
cgtcacaacgagcctgcccttgccttccagctggagctcggccgtttgtccaagttcaag
atcaagcccgtcttcactgagaaccggaacatccacgtctacgaggccatcggaaagggc
cccgagaacgacaaggctgtggacaagcgctacttcgttcgtgccgtcgtgcgccccggt
cgcctgcgcgatgatatccccaccgcggagtacctgacctcggaggctgaccgtctcatg
aacgacattctggacgccctggagatcatcggcaacaacaactccgacttgaaccacatc
ttcatcaacttctcgcctgtcttcaacctgcagcctaaggatgttgaagaggctctggcc
ggtttcttggagcgctttggccgtcgtctctggagactccgtgttaccggtgctgagatt
cgcatcctgtgcaccgaccccgtcactggtgttccctaccctctgcgtgtcatcatcacc
aacacctatggattcatcatccaggttgagctgtacattgagaagaagaccgagaagggc
gagtggatcttccacagcattgatggtggcagcaacaagctgggttccatgcacttgcgt
cctgtctccactccttacccgactaaggaatggctgcagcccaagcgctacaaggcccac
ctcatgggtactcagtacgtctatgacttccctgagctcttcagacaagccttccagaac
agctggaccaaggccattgccaacatcccctccttggccgaccagcgccctcccgttggc
gagtgcatcgactacagcgagcttgtccttgatgacaccgacaacctggtcgagatttcc
cgcggccctggcaccaacacccatggtatggttggttggatcgtcactgcccgtaccccc
gagtacccccgtggtagacgcttcatcattgttgccaacgacatcaccttccagattggt
tctttcggtcccgctgaagacaaattcttccacaagtgcactgaacttgctcgcaagctg
ggtatccctcgtatctacctttctgccaactccggtgctcgtatcggcatggctgacgag
ttgatcccttacttctccgtcgcctggaacgaccccgagaaccccgccgccggtttcaag
tacctgtacttcaccccggaggtcaagcagaagctggatgccagcaagaagaaggaagtc
atcactgaggagatccaagatgagggtgaagtgcgccacaagatcaccaccgtcatcggt
gctaaggacggtctgggtgtcgagtgtctcaagggttccggtctgattgccggtgctacc
tccaaggcttacgaggacatcttcaccatcaccctcgttacttgccgttccgttggtatt
ggtgcctaccttgtccgtcttggacagagagctatccaggtcgagggccagccgatcatt
ctcactggtgcccccgctatcaacaagctgttgggtagagaagtgtacacttccaacttg
cagcttggtggcacccagatcatgtaccgcaacggtgtgtcccacatgactgccaacgat
gacttcgagggtgtgcagaagattgtcgagtggatgtctttcgtccccgacaggaagggt
gcccccatccctatccgcccctggtccgacacttgggaccgcgatgtcgcctactaccct
cccgccaagcagccctacgatcctcgctggctcattgccggtaaggaagacgaggaaggt
ttcctgcctggattgttcgatactggctctttcgaggaggctcttggtggctgggctcgc
accgtcgttgttggtcgtgccagactcggcggcattcccatgggtgtgattgctgttgag
actcgctccgttgagaacgtcactcctgccgaccctgccaaccccgactctatggagatg
gttgccaacgaagctggtggtgtctggtaccccaactccgcctacaagaccgcccaggcc
ctccgtgacttcaacaacggtgagcagcttcctgtcatgatcctggctaactggagaggt
ttctccggtggtcagcgtgacatgtacaacgaggtcctcaagtacggttcttacatcgtc
gatgccctcgtcaagtacgagcagcccatcttcatctacatcccgccccatggtgagctt
cgtggtggatcctgggtcgtcgtcgatcccaccatcaaccccgaccagatggagatgtat
gccgatgtggaagctcgtggtggtgtcctcgagcccgagggtatcgtcaacatcaagtac
cgtcgcgacaagcagctcgacaccatggctcgtctggatgccacctatggcgagctccgc
cgctctctcgaggacccgtccctcagcaaggagcagctctctgatgtcaaggccaagatg
gctgcccgcgaggagcagctcctgcccgtctacctgcagattgctctgcagttcgctgat
ctccacgaccgtgctggccgcatggaggccaagaacaccatccgccatcctctcacctgg
aagaacgcccgtcgcttcttctactggcgtctgcgccgcagactcagcgaggagctcatc
gtcaagcgcatggttgctgccgctcccaaccctgctgctcgcgacggctctgttgctatc
cctgctggttccaacgcccctgtctcgaccgagtccgctcgtgctgtgcacctccgcact
ctccacggctggaccggcctgcttgacgacgaactgcagcgcgaggaccagcgcgtcgct
acctggtacgaggagaacaagaaggccatccagaccaaggtggactccctcaaggccgag
agcgtggccacagaagttgcgcagctgctcgtcaacaaccgcgacggtgctctgaagggt
gtgcagcagatcctcagtgtcctccctgtggaggagaaggaggctgttctcaagtacctc
tcttccaactaa

DBGET integrated database retrieval system