KEGG   Aspergillus niger: ANI_1_1778134Help
Entry
ANI_1_1778134     CDS       T01030                                 

Gene name
An15g07500
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ang  Aspergillus niger
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ANI_1_1778134 (An15g07500)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ANI_1_1778134 (An15g07500)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MAPPQICVIGSLNIDFVTYTPRCPDAGETLTANSLAISAGGKGANQAVACGRASFVSKDN
QDASVYMIGAVGACDPYYSALLRPTLEGSGVSTTGIQEKTDSQTGSATIIVDEGAGGENR
ILFVPGANYSGMDNVDAVLATTRNIHLEQGVVVMQGEIPRSTTLELMKHFNDPSCPSHLV
FNPAPVFTEGIPLAALAGTSVLAMNETEAVLMTQAVKEHLTPAQQEQDLKPEELAPLFHK
HAQVQIVLITLGAKGAFYSTATGKQGFAPSAAVEKVVDTTAAGDTFVGYFATAFAKFVAT
GAPLAEFDAQIETAVRKANVAAAGCVQRKGAMQSIPFAYEI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctccgcagatctgtgtgattggttccctgaatattgatttcgtcacctacacc
ccccgttgccccgatgctggcgaaaccctgacagccaattccctcgccatcagcgccggc
gggaaaggtgccaaccaggcagtcgcgtgcggtcgcgcctcctttgtttccaaagacaac
caagatgcatcggtgtatatgatcggagcggtaggagcgtgtgatccttactactcggcg
ctcctgcgcccaacactggagggttccggagttagcacaacgggaatccaggaaaagacg
gacagccaaacgggctctgctacgatcatcgtggatgaaggagccggaggagagaatcgg
atcttgtttgtccccggcgctaactactcgggaatggataatgtagatgcggtcctcgcc
accacccggaatatccatctagaacaaggcgtcgtcgtgatgcagggcgagatcccgagg
tcgactaccttggagctgatgaagcacttcaacgacccttcctgcccttctcacctggtg
tttaatcctgcgccggtcttcacagaaggaatccccctcgctgcacttgccggcacgagt
gtgctggccatgaatgagaccgaagctgtcctcatgactcaggcggtcaaggagcatctc
acccctgcccagcaggagcaggacctaaagcccgaagagctggcacctttattccacaaa
catgctcaggttcagatcgttctaattacacttggagccaagggtgccttttactccacg
gccactggcaagcagggctttgctcccagcgccgcggtggagaaggttgtagacaccact
gccgccggagacacatttgtcggttacttcgctactgcctttgctaagtttgttgccacc
ggtgctccactggcggaattcgatgctcagattgaaacggccgttcggaaggcgaacgtg
gccgccgcagggtgtgtccagaggaagggtgcgatgcagagcattccgttcgcttatgag
atctag

  All links  
No link information was found.   
DBGET integrated database retrieval system