KEGG   Aspergillus niger: ANI_1_1778144Help
Entry
ANI_1_1778144     CDS       T01030                                 

Gene name
An16g05350
Definition
folic acid synthesis protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ang  Aspergillus niger
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ANI_1_1778144 (An16g05350)
Enzymes [BR:ang01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ANI_1_1778144 (An16g05350)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ANI_1_1778144 (An16g05350)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 431 aa AA seqDB search
MDRVHPSTHRAFIAFGSNVGDRIDMIEAACREMERANIRIKRTSSLFETAPMYVLDQDPF
INGVCEVETSLSPMDLLDTLQAIELGLGRKKLIDKGPRSIDLDILLYDEQIFTHERLDIP
HKLMLERDFVLRPLCQYTNPSRTPSLPGTNPSRPTHIMAILNLTLDSFSDGGTHSPTDLA
TLTTTVNNMIRSGATIIDIGGESTRPGSKPVSESEELSRVIPAIRHIRTTIPEAAHIAIS
IDTYRARVAEAACAAGADIINDVSAGLLDPEMLPTMARTGKSVILMHMRGTPATMTKLTD
YPNGVIQDVGSELLERVAAAEAAGIRRWRIILDPGLGFAKNEPHDLTILRELEKLRTGVE
GLEYFPWLMGPSRKRFVGRLTGVKEAKDRTWGTAATVTASVAGGADIVRVHDVKEMWQVG
RVADAIYRGVV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagtacatccctcgacccatcgtgcgttcattgcctttggcagcaatgtcggg
gaccgcattgatatgatcgaggctgcttgccgcgaaatggagcgggccaacatccgaatc
aagcggacgagctccctcttcgaaaccgccccgatgtatgtcctcgaccaggatcccttc
atcaatggagtgtgcgaggtggaaaccagcctctcccccatggacctgctcgacacgctc
caagccatcgagttaggcctcggccggaagaaactcatcgacaagggaccacgctcaatc
gacctggacatcctcctctacgacgagcaaatcttcacgcacgagcgtctcgacatcccg
cacaaactgatgctcgagcgcgactttgtcctccgacccctctgccagtacactaatccc
tcacgaacgccctcccttcctggcaccaacccctcccggccaacccacattatggcaatc
ctaaacctaaccctagactccttctccgacggcggcacgcactcacccacagacctggca
accctaaccacaacagtaaacaacatgatccgctccggcgcaacaataatcgacatcggc
ggcgaaagcacccgtccgggctccaagcccgtcagcgaatccgaggaattatcccgggtg
atccccgcaatccggcacatccggaccaccatccccgaggccgcccacatcgccatcagc
atcgacacgtaccgcgcgcgcgtcgctgaagccgcctgcgccgccggcgcggacatcatc
aacgacgtctccgcgggcctcctcgaccccgaaatgctgcccactatggcgaggaccggg
aaatcagtcatattaatgcacatgcgcggcacacctgccacgatgaccaagctgacggat
taccccaacggagttatccaggatgtgggcagtgaactccttgagcgggttgcagccgca
gaggcggcggggatccggcggtggaggatcatattagatccggggctggggttcgcgaag
aacgagccgcatgatttgactatcttgagggagttggagaagttgaggacaggagtggag
gggttggaatatttcccgtggttgatggggccgagtcggaagaggttcgtggggaggttg
acaggggtgaaggaggcgaaggatagaacttggggcacggcggcgacggtgacggcgagt
gttgctgggggcgcggatattgtcagggtgcatgatgtgaaggagatgtggcaggttggg
agggtcgcggatgcgatttataggggggttgtttga

DBGET integrated database retrieval system