KEGG   Aspergillus niger: ANI_1_1778144Help
Entry
ANI_1_1778144     CDS       T01030                                 

Gene name
An16g05350
Definition
folic acid synthesis protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
ang  Aspergillus niger
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ang00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 431 aa AA seqDB search
MDRVHPSTHRAFIAFGSNVGDRIDMIEAACREMERANIRIKRTSSLFETAPMYVLDQDPF
INGVCEVETSLSPMDLLDTLQAIELGLGRKKLIDKGPRSIDLDILLYDEQIFTHERLDIP
HKLMLERDFVLRPLCQYTNPSRTPSLPGTNPSRPTHIMAILNLTLDSFSDGGTHSPTDLA
TLTTTVNNMIRSGATIIDIGGESTRPGSKPVSESEELSRVIPAIRHIRTTIPEAAHIAIS
IDTYRARVAEAACAAGADIINDVSAGLLDPEMLPTMARTGKSVILMHMRGTPATMTKLTD
YPNGVIQDVGSELLERVAAAEAAGIRRWRIILDPGLGFAKNEPHDLTILRELEKLRTGVE
GLEYFPWLMGPSRKRFVGRLTGVKEAKDRTWGTAATVTASVAGGADIVRVHDVKEMWQVG
RVADAIYRGVV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagtacatccctcgacccatcgtgcgttcattgcctttggcagcaatgtcggg
gaccgcattgatatgatcgaggctgcttgccgcgaaatggagcgggccaacatccgaatc
aagcggacgagctccctcttcgaaaccgccccgatgtatgtcctcgaccaggatcccttc
atcaatggagtgtgcgaggtggaaaccagcctctcccccatggacctgctcgacacgctc
caagccatcgagttaggcctcggccggaagaaactcatcgacaagggaccacgctcaatc
gacctggacatcctcctctacgacgagcaaatcttcacgcacgagcgtctcgacatcccg
cacaaactgatgctcgagcgcgactttgtcctccgacccctctgccagtacactaatccc
tcacgaacgccctcccttcctggcaccaacccctcccggccaacccacattatggcaatc
ctaaacctaaccctagactccttctccgacggcggcacgcactcacccacagacctggca
accctaaccacaacagtaaacaacatgatccgctccggcgcaacaataatcgacatcggc
ggcgaaagcacccgtccgggctccaagcccgtcagcgaatccgaggaattatcccgggtg
atccccgcaatccggcacatccggaccaccatccccgaggccgcccacatcgccatcagc
atcgacacgtaccgcgcgcgcgtcgctgaagccgcctgcgccgccggcgcggacatcatc
aacgacgtctccgcgggcctcctcgaccccgaaatgctgcccactatggcgaggaccggg
aaatcagtcatattaatgcacatgcgcggcacacctgccacgatgaccaagctgacggat
taccccaacggagttatccaggatgtgggcagtgaactccttgagcgggttgcagccgca
gaggcggcggggatccggcggtggaggatcatattagatccggggctggggttcgcgaag
aacgagccgcatgatttgactatcttgagggagttggagaagttgaggacaggagtggag
gggttggaatatttcccgtggttgatggggccgagtcggaagaggttcgtggggaggttg
acaggggtgaaggaggcgaaggatagaacttggggcacggcggcgacggtgacggcgagt
gttgctgggggcgcggatattgtcagggtgcatgatgtgaaggagatgtggcaggttggg
agggtcgcggatgcgatttataggggggttgtttga

DBGET integrated database retrieval system