KEGG   Aspergillus niger: ANI_1_178124Help
Entry
ANI_1_178124      CDS       T01030                                 

Gene name
An14g01050
Definition
protein kinase Yak1
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ang  Aspergillus niger
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 895 aa AA seqDB search
MDSQWQAYQDPLMGHPAQFNNGLTSNPQQLASKYGAQPQHSQPPVGYTYEPFQSPGTTAK
PPSIGANSRTVSMASSPAATPRSRDYVTDADTTMEDADPYNRAKYSTRPSHHSRPSSQYF
PSEESSAARRYSPMNVLSPSMSFNASPGKSHNSYAFPPGPNQPRRSPTRGSTYASPPQAF
QSPPSASRPPRLPPLQPTDMSPDQYYPPSAGSQLNAAFAQDGRSPRSASISGGSQQPGRG
PVPKFQKIKSIQELQPRMNAQPPYRRANPDGGFISPLQALTTHLPATYRICNPGFNYESS
RNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGSEEAGHKNRYLILDVLGQGTFGQVV
KCQNLKTGEVVAVKVIKNKTAYFNQSMMEVSVLDLLNSRYDKNDDHHLLRLKDTFIHRQH
LCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNALSLLNKAHLIHCDLKPENILL
KNLESPIIKVIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAIDMWSLGCIVVELF
LGLPLFPGSSEYNQVCRIVEMLGLPPTWMLEMGKQSGEFFEKTQDEFGRKTYRLKSLEQY
SREHNTKEQPSKKYFQASTLEEIIRSYPMPRKNMKQAEIERELNNRVAFIDFVRGLLAIN
PLERWSPQQAKLHPFITQQKFTGPFMPPMNLKYSSLNKTVPPGIQQQQQAEAASKQRAAQ
AAHAQSAAQNAYAMQLNQFHTPTHAQPPPMYNGIFTGHQQGAPPPYPTQPPAYGHQMNLI
PGQVPQAQYAPSQSLYAQATTRAGRQRASTMDPQGGGIPPTIQRVASHLDPNAPIRLQPS
PAYYPPPPDGYVDPNSAGQRRRGSRTGGTRNRDFIRTLEDGVLGGEGFMGQNQWH
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggattcccagtggcaggcataccaggatcccttaatggggcatcccgcgcagttcaac
aacgggttgacgtctaatccacaacagctagcctcaaaatacggcgcccagccacagcac
tcgcagccgccggtgggctacacctacgaacccttccagtctcctggcaccaccgccaaa
ccaccatccatcggtgcaaattccagaaccgtctctatggcttcgtctcccgctgcgacg
ccacgtagtcgggattatgtcaccgatgcggacaccacgatggaagatgcggatccgtac
aaccgggccaagtactcgacaagaccgagccatcatagccgaccgtcatcccaatatttc
ccaagcgaagagtcgtcagctgctcgcaggtactcccctatgaatgttttgtctccttcc
atgtcgttcaatgcgagtcctggaaaatcgcataactcgtatgctttcccgcccgggccg
aatcaaccacgacggtcgccgacaagaggttcaacctacgcctcacctcctcaggcgttc
caatccccaccctctgcgtcacgcccccctagacttcccccgcttcagcctaccgacatg
agccccgatcagtactatccaccctcggcgggctcacagctcaacgccgcatttgcacaa
gatggaaggtcaccgcgctctgcgtctatatccggtgggagccagcagccaggccggggc
cctgttccgaagttccagaagatcaagtccatccaggaacttcaaccacgcatgaatgcg
cagccaccttacagacgcgccaaccctgatggtggtttcatcagccctctgcaagcgttg
acaacacatctccccgccacttatcgaatatgcaacccgggcttcaactacgaatcgtcc
cggaacccgaggcgtgttcttaccaagcctagtaaaggcgtgaagaacgatggttacgat
aacgaggatagtgactacattctctatgtcaatgacatcttgggcagtgaggaagcgggc
cacaagaaccgttacctcattcttgatgtgctgggtcaaggaaccttcggtcaagttgtc
aagtgtcaaaacctgaaaactggggaggttgtagctgtcaaggtcatcaagaacaagact
gcatatttcaatcaaagcatgatggaggtgtcggttttggatttgctcaacagcagatac
gacaagaatgacgaccaccacttactccgcttgaaagatactttcattcaccgacagcat
ttgtgcttggtgtttgaattgttgagtgtgaatctctacgaactgatcaagcagaatcag
ttccggggcttaagtacgacattagtacgcgtatttgctcagcaacttctgaatgcattg
agccttttgaacaaggcgcacttgattcactgcgatctgaagccggagaatattctacta
aaaaatctggagagccccattatcaaagtcattgactttggttcagcctgtgacgagcga
cagacagtctatacctatattcaatctaggttttaccgctcaccagaggttcttcttggc
ttaccctactcatccgcgatagacatgtggtctcttggttgcatcgtcgttgagttattc
ctaggcttgccgcttttccctggatcttcggaatacaaccaagtctgccgcattgtggaa
atgctcggcctgccgccaacatggatgctggagatgggcaagcagtctggcgaattcttt
gagaagacccaggacgagttcggtcgcaagacatatcgccttaaaagtctagagcaatat
tctcgagagcacaacacgaaagagcagccgagcaagaagtacttccaagcgtcgaccctg
gaagaaatcatccgcagctacccgatgccgaggaagaatatgaaacaagcagagattgaa
cgagaattgaacaaccgggtagccttcattgacttcgttcgtggcctattggccatcaat
cccctcgagcgttggtcgccacaacaggccaaactgcatcctttcattacgcaacagaag
ttcacaggcccttttatgcccccgatgaacctgaagtactcatctctgaacaagactgtt
ccccctggaattcaacagcagcagcaggcagaagctgccagcaagcagagggccgcacaa
gcagcccatgcccagtcagccgcacagaatgcctacgctatgcagctgaatcagttccac
acgcccacgcatgctcagccgccgccaatgtacaatggaatctttactggtcatcagcaa
ggtgcccctccgccctaccccacgcagccaccggcgtacggtcatcagatgaacctcatc
cctggccaagtgccccaagcacagtatgcgccctcccagagcctctacgcgcaagcgaca
acaagggctgggcggcaacgggcgtctaccatggatcctcagggtggaggtattccgcca
acaatccagcgtgtggccagccacctcgaccccaatgcacctattcgattacagcctagt
ccggcatactaccccccacctccagatgggtatgtcgaccccaattccgctggtcagagg
cgacgaggaagtcgtacaggcggtacaagaaaccgcgacttcattcgaaccctcgaggat
ggggtgttagggggtgaaggctttatgggccaaaaccagtggcattga

DBGET integrated database retrieval system