KEGG   Aspergillus niger: ANI_1_1798134Help
Entry
ANI_1_1798134     CDS       T01030                                 

Gene name
An15g07670
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ang  Aspergillus niger
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    ANI_1_1798134 (An15g07670)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ANI_1_1798134 (An15g07670)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     ANI_1_1798134 (An15g07670)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 341 aa AA seqDB search
MKFPSFLVALALAATTSAAAVPHSSMKTDHTETTSYDIPGFFSRNCTREKMTVRKEWRHL
TTHEQNSFLDSVQCLMNKPAESGLTATTSRFSDLQALHRGMTNTAYADIIHHVGQFLPWH
RYYMHIYEALLRNECGYDGPIPWWDEQKDADSGNMWQSSMWGADAFGGNGTGSDNCVRDG
RFSNLTLHIGPGDEDTDYCLRRAWNTEKAIANANSTVLEMCNAYNTYAPWWNCISNIPHK
GVHTYIGGVMADIKSSPGDPIFFMHHMYIDRVWWKWQQQDPINRLYDISGPTLNHTANVE
PAGGWQNATLHYELSSFNIMPNITIAEVMNTQGGYLCYGYD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcccttcgttcctggtagcattggctctggcagccactacctctgctgctgca
gtcccccattcatctatgaaaactgaccacacggagaccacttcgtatgatattcccgga
ttcttcagccgcaactgcactcgcgagaagatgactgtccgcaaggaatggcgccacttg
accacgcacgagcagaacagttttctggactcggttcaatgcttgatgaacaagccagcc
gaatccggtctgacagcaacgaccagtcggtttagtgacctccaggcccttcaccgtgga
atgaccaacacggcgtatgcggatatcatccaccatgtgggacaattcctcccctggcac
cgctactacatgcacatctacgaggccctgcttcgtaacgagtgtggatacgacggtcct
attccctggtgggatgagcaaaaggatgccgatagcggcaacatgtggcaatcatcgatg
tggggagccgatgcctttggaggcaatggtaccgggtccgacaactgtgtgcgcgatggt
cggttttccaacctcactttgcacattgggccgggtgatgaagacacggactactgcttg
cgccgcgcatggaacaccgagaaggcgattgccaacgccaacagcaccgtgctagagatg
tgtaatgcttacaacacctatgctccatggtggaattgcatctccaacattccccacaag
ggtgtacacacctacattggtggtgtgatggcagatatcaagagctcgcccggcgacccg
atcttcttcatgcaccacatgtacattgatcgggtttggtggaagtggcagcagcaagat
cccatcaaccggttgtacgacatcagcggtccgactctgaatcacacggccaacgtggaa
ccagctggaggttggcagaacgctacccttcactacgaactctcctcgttcaacatcatg
cctaacatcactattgccgaggtgatgaacacccagggaggttacctgtgctacggttat
gactga

DBGET integrated database retrieval system