KEGG   Aspergillus niger: ANI_1_1874064Help
Entry
ANI_1_1874064     CDS       T01030                                 

Gene name
An07g06130
Definition
WD repeat-containing protein mip1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ang  Aspergillus niger
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1425 aa AA seqDB search
MEPTIQQASQPEPRKSHHKSVRVAFGPDLETHIPPRDRSPAPVPGHHRSFTTVEHKQPPV
ITPERPTSSSAGENPVIIENNGRLASDRSSESGRPIATLKRARSDYGPRVGLDKAIAADE
EEDIAMRHGWQEEYTSSEYLKVLHSNFYMYFTEKRHETNGIPRDPVGSWPSQDWRMKDRL
KTVSAALAICLNIGVDPPDVVKTNPTAKLECWVDPTSTTGGGHNKIMEQIGKKLQEQYET
LSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTQSGEIWVFNKNYT
QYIPVSLYDLQSWLAGPSLFVFDVSHAGNIVQNFHTFVEKHEKENAEAKKRDPNAIVQNY
GDCIILAACQKTESLPTNPDLPADIFTCCLTTPIEIALRFFILQNPLQTNISIDEFRVPG
RLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFRNFLLAERIMRTY
KCHPISSPELPETHHHPLWKSWDLAVEMVLSQLPALIDHEEGRRQYEYQHSTFFAEQLTA
FEVYLSSGPTEKNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVHLALSIGIFPY
VVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFISILNPSSPIPVGNASE
HRAMCAFIVSIFCKNYPQGQNVCLSAELFDSCLKHLMDVENPLLRQWSCLCISMLWSDFP
EAKWMGIRCAAPARLCELNFDPVPEVRAAMLHAVTTFLGIPDLTDQVAQIEESLAMTVLP
MASDGSVLVRKELLVFFSTFVRRYQNKFLVAAYEEFQDEKQNLQLKLEQDGTRSLSLEDV
PNISANGSTDPTHRSQILSRNTTFGTIWKQLLILSVDPHPDIAQDAAMVVDYIHICLLQS
PMAALTNKIRNEILDLSSRVSQKFQVRERPESKKTAPPPTPPSAAPPKQEGYLSLSLKRT
ASVAASLKNLAFGNSSAAEAQSQQTSTAPKSRVPMTPRGRAPPEWTRPPEVNDQVAPATA
YHQAPTPTSRGFEPRDPTAVPTIPLMSRFLDWSTEYFREPQMKPNEPDEPGSADYNERLW
RRSRNEKIISETQPLKGVAGSSRWDNSLSLLSNSSQPLKMCFHQFEDHLAVADDRDTIAI
WDWQSHKRLNRFSNGNPAGSKINEVRYINEDDQALLMTGSSDGVLKVFRNYESSKKVEIV
TSFRALPELIPSNRNAGLVLDWQQGQGKALVAGDVKVIRVWNAATEVCTNDIPARSGSCI
TSLTSDQVAGNIFVAGFGDGAVRVFDQRLKPTTSMVKVWREHKQWITNVHMQRGGLRELV
SGSRNGEIRLWDLRMDTPFSTFSATRDTLRTLSVHEHAPVFMVGTNRHEVKTFNVNGTYL
STFEPYSSFLHHNRSSPIASTAFHPHRTLLACAALNDNHINLVNC
NT seq 4278 nt NT seq  +upstreamnt  +downstreamnt
atggagcccacaatccagcaggcatcgcaacccgaacctcggaagagtcaccacaagtct
gttcgggttgcctttggtccggatctagaaacacacattcccccgcgtgacagatcaccc
gctccagttccaggacatcaccgatcattcactaccgtggagcacaaacagcctcccgtt
atcacacccgaacgaccgactagctcatctgcaggcgagaacccggtgatcatcgagaac
aatggccgactggcttcggatcgatcgtcggaatctggaagaccgattgcgaccctgaag
agggcccgcagcgactatgggcccagagtggggcttgataaagccattgctgcggatgag
gaagaggacattgccatgagacacggatggcaggaggaatatacctcgagcgagtacctg
aaagtcctgcactcgaatttctacatgtattttacagagaagcgccatgagacgaacggt
atccccagggatccggtcggaagctggcccagtcaagactggcgtatgaaagaccgcctg
aaaaccgtctctgctgcgctagccatctgcctgaacatcggcgtcgacccgcccgatgtg
gtcaagacgaacccgacagctaagttggaatgctgggtcgatcccacgtccactaccggc
ggtggtcacaataagatcatggagcagatcggaaagaaactacaggagcaatatgagaca
cttagcttaagaactaggtacaagcaatatcttgacccctctgtcgacgagacgaagaag
ttttgcatctctctgcgccgtaacgccaaggacgagcgagtgctgtttcattataacggc
catggtgttcctctccctactcagtcgggtgagatttgggtcttcaacaagaattacacg
cagtacattccggtatccctctacgacttgcagtcctggcttgcaggacctagcctgttc
gtcttcgacgtgtcgcatgccgggaatatcgtacagaattttcacaccttcgttgagaaa
catgagaaggagaacgcagaggcgaagaagcgggatccaaatgccatcgttcaaaactac
ggggactgtatcatcctcgcagcgtgtcagaagacagagtcgctcccaactaaccccgat
ctccctgcggatattttcacatgttgcttgactacgcctatcgaaattgccctgcgcttc
ttcatcctccagaatcccctgcagacgaatatctcaattgacgagtttagagtgccaggc
cggttacaggaccggaggagcccattaggagagctgaactggatcttcactgcgattacg
gacactatcgcctggaacaccttgccacgggcgctgttcaagaagcttttccgtcaagat
cttatggtcgctgctttgtttagaaactttctgctcgccgagcgtatcatgcgcacatat
aagtgtcatcccatttcatctcctgagcttccagaaacccaccatcacccgctgtggaag
agctgggatttggcagtcgagatggtcttgtcgcaattaccggctctgattgatcacgaa
gagggtcgcaggcaatatgagtatcagcattcaacattctttgccgagcagcttacggcg
ttcgaggtttacctgtcgtcaggtccaacggaaaagaatcccccagatcagcttccgatt
gtgctacaggtccttctcagtcaagcacatagactcagggcgttgatattgcttagcaaa
ttcctggacctgggaccttgggctgtccatctggctctgagcatcgggatctttccatat
gtcgtaaagctcctgcagtctgcagctcaagaattgaagccagtgatggtctttatctgg
gccaggatcatggccgtcgatcatacagtccagaacgatctgttgaaagacaacggaatc
cattactttatttccatcctcaacccttcctcgccgattccggtgggcaatgctagcgaa
catcgagcgatgtgtgcgttcatcgtctcgatattttgcaagaattatcctcaaggccag
aatgtgtgcctttctgctgagctctttgactcttgcctcaagcaccttatggatgtggaa
aaccccctgttgcggcaatggtcgtgtctctgtattagcatgttgtggtcggactttcct
gaagcaaagtggatgggcatccgttgcgctgctcctgcaagactttgcgagcttaatttc
gatccggtcccagaggtccgagctgcaatgctccatgcagtaacgacgttcttgggtatt
cctgatttgacagaccaggttgcccaaattgaagagtcactggctatgacggtgctgcct
atggcatcggacggcagtgtcctggtgaggaaagaactcctggtctttttctcaacgttc
gtgaggcgctatcagaacaaattcctggttgctgcctacgaggaattccaggacgagaag
cagaacctccagctgaaactggaacaagatggtactcggagcctttccttggaggatgtg
ccaaatatctccgcaaatggctccacagatcccacccatcggtcacagatattgtcccgg
aacacgacttttggtacaatttggaaacaattacttattctttctgttgatcctcatccc
gacattgctcaagatgcggccatggtcgtcgactacattcacatctgtcttcttcaatcc
cctatggcagcgctaactaacaagattcgcaatgagatcttggatctctcgagtcgtgta
tctcagaagttccaggtccgagaaaggccagagtccaagaagactgccccaccgccgaca
cctccttccgcagcaccaccgaaacaagaaggctatctgtcactgagcctcaaacgaacg
gcgagtgtcgctgcatcgctcaagaacttggcatttggcaattcatccgccgccgaggcg
cagtcgcagcaaacgtcaacggccccgaagagtcgagtgcccatgacaccgagaggacga
gcccctcccgaatggacgcggcctccagaggttaacgaccaagtcgctcccgcgactgca
tatcaccaggccccaacccctacttcacgaggctttgaacccagagatcccacggctgtt
ccgacgatccccttgatgagcaggttcctagattggtccacagagtacttccgggaaccc
cagatgaaacccaatgagcccgacgagcccggtagtgcggactacaacgaacgcctttgg
agacggagtcgcaacgagaagatcatttcggagacccagcccctgaagggagtagccggc
agcagccgatgggacaattcgttgtctctcttgtctaacagcagtcaacccttgaaaatg
tgcttccaccaatttgaggatcatctcgcagtggcggacgacagggatacgattgcgata
tgggactggcagagccacaaacgcctcaaccgcttttctaatggcaacccagcaggctcg
aagatcaacgaagtacggtacatcaacgaggatgatcaagcactcttgatgactggttcc
tccgatggcgtcttgaaagtgtttaggaactatgagtcctccaaaaaggttgagatagtt
acgtcttttagggctctgccggaattaatccccagtaaccggaatgcgggcctggttctc
gactggcagcagggtcagggaaaagcgttggtcgcaggagacgtcaaggtcattcgtgta
tggaatgcagctaccgaagtgtgcaccaacgatattcccgcaaggtccggttcttgtata
acttctttgacgtcggatcaagttgcaggaaatatcttcgtggctggatttggcgatggc
gctgttcgagtgtttgatcagcgtctcaagccgacaacctccatggtcaaggtctggcgt
gagcacaagcaatggattaccaacgtccatatgcaacgcggtggattgagagaactggtg
tctggtagccgaaatggcgagattcggctatgggatcttcgaatggacacgcccttttca
acgttctcagcgaccagggacacgcttcgcacattgagcgtgcatgaacacgctcctgtg
ttcatggtgggtaccaaccgacacgaagtcaagacgttcaacgtcaatggtacatatcta
tccaccttcgagccctactcgagcttcctccaccacaaccgctcgtccccgattgctagc
acggctttccaccctcaccgcaccctgctggcgtgtgctgccctcaacgacaaccacatt
aacctcgtgaactgctaa

DBGET integrated database retrieval system