KEGG   Aspergillus niger: ANI_1_1926024Help
Entry
ANI_1_1926024     CDS       T01030                                 

Gene name
An02g13920
Definition
ubiquitin hydrolase L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ANI_1_1926024 (An02g13920)
Peptidases [BR:ang01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   ANI_1_1926024 (An02g13920)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 250 aa AA seqDB search
MTDTADAPQTNKAFVPLENNPEVMTHLVRQLGLSPTLGFTDVWSIDSPDLLAFIPRPSYA
LLLVFPVSAAYEATRRTEDAPLPDYTGSGPNEPVMWFKQTIRNACGLIGLLHAVSNGTPR
KHITPGSDLDNLLKEAEGLGPIQRADLLYESKALESAHADAAKLGDTDAPAAEDSVDLHF
VAFVKGEDGTLWELDGRRKGPLVRGVLEEGEDALSERALQLGVRRFLEVEKGSGDGDLRF
SLVSLGEVFD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacagcagatgccccccaaaccaacaaggccttcgtgcccctcgaaaataac
cccgaagtaatgacccacctcgtccgccaactcggcctctccccaaccctcggcttcaca
gacgtgtggtcaatcgacagcccggacctcctcgccttcatcccccgcccctcctacgcc
ctcctcctcgtcttccccgtctccgccgcctacgaagccacccgccgaaccgaagacgcg
cctctccctgattacaccggctcaggtcccaacgagcccgtcatgtggttcaagcaaacc
atccgcaacgcctgcgggctaatcgggctcctgcacgccgtgtcgaacggcacgccgcgg
aagcacatcacccctgggtccgatctagataacctgctcaaggaagcggagggtttgggg
ccgattcagcgcgcggatctgttgtatgagagtaaggcgttggagagtgcgcatgccgat
gcggcgaaactgggggatacggatgcgccggcggccgaggactcggtggacttgcatttt
gtggcgtttgtgaagggtgaggatgggactttgtgggagttggatgggaggaggaagggg
ccgttggttaggggggttcttgaggagggggaggatgcgttgagtgagagggctttgcag
ttgggggtaagaaggttcttggaggtcgagaaggggagcggggatggagatttgaggttt
agtcttgttagtttgggggaggtttttgactga

DBGET integrated database retrieval system