KEGG   Aspergillus niger: ANI_1_1928184Help
Entry
ANI_1_1928184     CDS       T01030                                 

Gene name
An04g05760
Definition
protein mst2
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ANI_1_1928184 (An04g05760)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1079 aa AA seqDB search
MPAIVPLANDPGSKTPADMVDSDQDAEGEEETDLYQMDQQLQDAAHRAFTGEAADDAATG
DLGEDQDAEGEPDNEMSLVGDQNDTEPVGAVKVPQNGQSADDEDAASEAADAEADPAFEN
QSDSDQEAHRSSSSSQESDEEWEGESNDQEDAEAETTVRGNCIFCGQDEDNDPSEEFEEY
LTCAVCGDHSHRQCAREQNALGDAEDANPWRCPTCVREKLKPSAEEGAAPQRKNRQKNMR
KELLPAHTGEDGSDFHSIFNTVTVNEELLNSSRSLRKRKTVSLSAEIEEHAPVLRKRQRQ
TPLRYDRADSREQMAETVDGMSPVRTRSRRTRRNEQEHCRVVLKQFERLVMAFRLNESKL
SKILNSRSRSQMRSRRTPKPPPVAHEPQAHFAPITPASYYTPFYSFSDRETDELKGKPYG
GILSEADADTSKTLPTHLDRERFEKARQKAEEEWQRRALEAESTGETVQHASQKVSGPPS
RIKYINFGGYEIETWYAAPYPEEYSRNRILYICEFCLKYMNSDYVAWRHKLKCPAKHPPG
DEIYREGSISIFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMTEFDDLGCH
FVGYFSKEKRPSSANNVSCILTLPIHQRKGYGNLLIDFSYLLTRIEGKTGSPEKPLSDMG
LVSYRNYWRLILSYQLRSQRTPLSITELSERTGMTADDIVSGLEALRALVRDPVTKTYAL
RLDYRYFEECIASWESKGYVQLNPDALVWTPYIMGRSNQSQFDRAPLHAVAPREGLEDEE
SEDVKESGNEEDQQSPTDAGDSKEDGSGPPITNGTGDADSEQLPTEPAGPPSTDMLSKVN
GFRHPITASATSSTPAESNPAGDVPAWRFEIYPPVQAPSHKKRPGRPFGSKSSKTGGTPI
AVRTSGRNTPRRASVLTSVTPSANPASVRRGRSAKLIDSPAVDSTSAEPDGIENEPYDDM
ENTPADGPDTTSQTHVSTEPELSANPAVGEDELPTSNGTTDPENEAAETPNVEPVTPSKG
KGVEGKPKLTKSVSRKSYVEKLELMVPAEDTALSAHENGVADKAERNGTDADGDAVMET
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgccggctatcgtaccgctggccaacgaccccgggtcgaagaccccggcggatatggtg
gacagtgaccaggacgcggagggggaggaggaaacggacctgtatcagatggatcagcag
cttcaggatgccgcgcaccgcgctttcaccggagaggctgcggacgatgctgcgactggc
gacctcggggaggatcaggacgcagaaggggagccagataacgagatgagtctggtcgga
gatcagaacgataccgagccggttggcgcagtcaaggtgcctcagaatggccagtctgcc
gacgacgaggacgcagcttcggaggccgctgacgcggaggcagatccggcgttcgaaaac
cagagtgatagcgaccaggaagcgcaccgttcttcgtcgagcagtcaggagtccgatgag
gagtgggaaggcgaaagcaatgaccaggaggatgcggaggcggagacaacggtccgcgga
aactgcatattttgtggacaagatgaagataatgacccgagtgaggagttcgaggaatat
ttgacatgcgcagtttgcggcgatcattctcatcggcagtgtgctcgcgagcaaaacgca
ctaggagatgcagaagatgccaacccgtggaggtgcccgacgtgcgtccgcgagaagttg
aagcctagtgcggaagagggcgcggcgccgcaacggaaaaacagacagaaaaacatgcgc
aaggagctcctgccggctcatacgggtgaagacggctccgactttcattcaattttcaac
acagtcactgtcaacgaggaactgttgaatagctctcggtcgctgcgaaagagaaagacc
gtgtccctctccgcagagatcgaggagcatgcacctgtgcttcgcaaacggcaacgccag
accccgttgcgctacgatcgtgcggactcccgcgagcagatggctgagacagttgatggc
atgtccccagtacggactcgttcgcgacgtacgcgtaggaacgagcaagagcactgtcgc
gtggtgttgaagcaatttgaacgtcttgtgatggcgtttcgcctcaacgagtctaagctc
tctaagattctcaattctcgcagcaggtcacagatgagaagcagaaggaccccaaagcca
ccacccgtcgctcacgagccacaggctcattttgcaccgatcacacctgcctcttattac
acaccattctattcatttagcgaccgtgagaccgatgagctgaagggcaaaccgtacggg
ggcatcctgtccgaagcggatgcggatacctccaagacactgccaacacacctcgaccgc
gaaaggttcgaaaaggcccgccaaaaagcggaggaagagtggcaacgacgagctctagaa
gccgagagcacaggcgaaactgtacagcatgcgtcgcagaaggtgtccggacccccatct
agaattaagtacatcaacttcggcggctacgagattgagacttggtacgctgcaccatac
cctgaggagtacagtcgcaatcgcattctctacatttgtgaattttgcttgaaatacatg
aactcagactatgtcgcgtggcgccataagctcaaatgcccggcgaaacaccctccggga
gatgagatttaccgtgaagggtccatatcgattttcgaagttgacggacggaaaaatccc
gtttactgtcaaaatttgtgcctgctcgccaagttgttcctgggctcgaagacactctac
tatgatgtcgagccattcctgttctatgtcatgacggagtttgacgatttgggctgccat
tttgttggctacttcagcaaagagaagcgccctagttcggcgaacaatgtctcttgcatt
cttacactccctattcaccaacggaaaggttacgggaacctcctcattgacttctcgtac
ttgctcacgcgcattgaaggcaagacgggctccccggagaagccactctctgatatgggc
ctggtttcttataggaactactggcgtcttattctatcctaccagttgcggagtcaaagg
acgccactcagtataaccgagctatctgagcggaccggtatgaccgcagacgacatcgtg
tccggtctggaagccttgcgggcgcttgtcagagacccggtaacaaagacctacgccttg
cggcttgactacagatatttcgaagagtgcatcgccagctgggaaagcaaagggtatgtc
cagcttaaccccgacgcgctcgtttggacaccttacatcatgggtcggagtaaccaatcc
caatttgatcgcgccccgttacacgccgtggcaccccgcgagggtctggaggatgaagaa
agtgaggacgtgaaggagtctgggaacgaggaagaccagcagtcaccaacagatgctggc
gactctaaggaggatggctctggtcctccgatcacgaatgggactggcgacgccgactcc
gaacagcttcccactgagccagctggacctccttctaccgatatgctctctaaagtgaac
ggcttccgccatccgattacggcatccgcaacctcgagtacaccggccgagtccaatccc
gctggagacgtccctgcctggagatttgagatttatcctcctgtgcaagcaccatcgcat
aaaaagcgtcctggccgaccgtttggtagcaagtcttccaagacgggcggaactccaatc
gctgttcgaaccagtggccgtaacactcccagacgagcatccgttttgacgtccgtgacc
ccttctgcaaatccagctagtgttcggcgcgggcgtagcgcaaagctgatcgactcccct
gcggtggattctacgagcgcagagccggatggtattgagaacgagccgtatgatgatatg
gagaacacaccggcagatgggccggatacgacgtcccagacccatgtatccaccgagccc
gaactgagcgccaacccagctgtcggtgaggatgagctgcccacatccaatggcactacg
gatccggagaatgaagcggccgagacgcctaatgtcgagcctgtaaccccttccaaaggc
aagggtgtggagggtaaacccaagctcaccaagtcggttagccgcaagtcctacgtggag
aagcttgagcttatggtgcctgccgaagacaccgctctatcggcgcacgagaacggcgtt
gcagacaaagccgagcgcaacggtaccgacgcggacggagacgctgtgatggagacctga

DBGET integrated database retrieval system