KEGG   Aspergillus niger: ANI_1_194104Help
Entry
ANI_1_194104      CDS       T01030                                 

Gene name
An12g01330
Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
ang  Aspergillus niger
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ANI_1_194104 (An12g01330)
Translation factors [BR:ang03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ANI_1_194104 (An12g01330)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MAAVAENGHAPVADENAAPVAAAVEQKEQTEKTNGDSVTVFHDPENFNVKHPLMHEWTLW
FTKPPSGKGDNWNDLLKEVVTFNSVEEFWGIYNNISPTSELGLKADYHLFKKGVRPEWED
PQNKHGGKWSYSFKDKRSVPIDDLWLHAQLAAIGETLENDGDNEVMGVVVNVRKGFYRVG
LWTRTVGKSIPGDKNGRTPAQGKEILENIGRRFKEVLRLKEADAVEFSGHTDSAHSGSTR
AKAKYTV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgttgctgagaacggccacgcgcccgtggctgacgagaacgccgcccccgtt
gctgccgccgtcgaacagaaggaacagaccgagaagacgaatggagactctgtcacagta
ttccacgaccccgaaaacttcaatgtgaagcatcctttgatgcacgagtggactctgtgg
tttaccaagccccctagcggcaagggcgataactggaatgatctgttgaaggaagtcgtg
actttcaactccgttgaggaattctggggtatctacaacaacatctcgccgacatccgag
ttgggcctcaaagcagactaccatctcttcaagaagggagttcgtcccgagtgggaagac
ccccagaacaagcacggaggcaagtggtcatactctttcaaggacaagcgctccgtgccc
atcgacgacctgtggctgcacgcacaactggccgctattggcgagactcttgagaacgac
ggtgacaacgaggttatgggtgttgttgtgaacgtacgcaagggcttctaccgtgttggt
ctgtggactcggactgttggcaagagtatccccggagacaagaatggtcgcacacccgca
cagggcaaggagatcctcgagaacatcggccggcgcttcaaggaagtccttcgtctcaag
gaggctgatgccgttgagttctcgggtcacacggacagcgcacacagcggcagcacgaga
gccaaggccaagtacactgtctaa

DBGET integrated database retrieval system