KEGG   Aspergillus niger: ANI_1_204164Help
Entry
ANI_1_204164      CDS       T01030                                 

Gene name
An18g01670
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ang  Aspergillus niger
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ang01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ang01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ang00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ang00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ang00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ang00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ang00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 783 aa AA seqDB search
MAPPQAPVQPPKRRRIGVLTSGGDAPGMNGVVRAVVRMAIHSDCEAFAVYEGYEGLVNGG
DMIRQLHWEDVRGWLSRGGTLIGSARCMTFRERPGRLRAAKNMVLRGIDALVVCGGDGSL
TGADVFRSEWPGLLKELVETGELTEEQVKPYQILNIVGLVGSIDNDMSGTDATIGCYSSL
TRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWLFVPEMPPKDGWEDD
MCAIITKNRKERGKRRTIVIVAEGAQDRHLNKISSSKIKDILTERLNLDTRVTVLGHTQR
GGAACAYDRWLSTLQGVEAVRAVLDMKPEAPSPVITIRENKILRMPLMDAVQHTKTVTKH
IQNKEFAEAMALRDSEFKEYHFSYINTSTPDHPKLLLPENKRMRIGIIHVGAPAGGMNQA
TRAAVAYCLTRGHTPLAIHNGFPGLCRHYDDTPICSVREVAWQESDAWVNEGGSDIGTNR
GLPGDDLATTAKSFKKFGFDALFVVGGFEAFTAVSQLRQAREKYPEFKIPMTVLPATISN
NVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLSVGAV
AVYIPEEGIDIKMLARDIDFLRDNFARDKGANRAGKIILRNECASSTYTTQVVADMIKEE
AKGRFESRAAVPGHFQQGGKPSPMDRIRALRMATKCMLHLESYAGKSADEIAADELSASV
IGIKGSQVLFSPMGGETGLEATETDWARRRPKTEFWLELQDTVNILSGRASVNNATWSCY
ENA
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggctcccccccaagctcccgtgcaaccgcccaagagacgccgcatcggtgtcttgacc
tctggtggcgatgctcccggtatgaacggtgtcgtccgggccgtcgtccggatggctatc
cactccgactgtgaggctttcgccgtctacgaaggttacgagggtctcgtcaatggcggc
gacatgatccgtcagcttcactgggaggatgttcgcggctggttgtcccgtggtggtacc
ttgatcggttccgcccgctgcatgaccttccgtgagcgccccggtcgtctgcgggctgcc
aagaacatggtcctccgtggcattgacgcccttgtcgtctgtggtggtgatggcagtttg
actggtgccgacgtttttcgttccgagtggcccggtctgttgaaggaattggtcgagacg
ggcgagttgaccgaagagcaggtcaagccataccagattctgaacatcgtcggtttggtg
ggttcgatcgataacgacatgtccggcaccgacgccaccatcggttgctactcctccctc
actcgcatctgtgacgccgtcgacgacgtcttcgatactgccttttcccaccagcgtgga
ttcgtcattgaggtcatgggtcgtcactgcggttggctggccttgatgtctgctatcagt
accggtgccgactggctgttcgtgcccgagatgccgcccaaggacggatgggaggatgac
atgtgcgctatcattaccaagaacagaaaggagcgtggaaagcgtaggacgatcgtcatc
gtggccgagggtgcccaggatcgccatctcaacaagatctcgagttcgaagatcaaggat
attttgacggagcggttgaacctggatacccgtgtgactgtgttgggtcacactcagaga
ggtggagccgcctgtgcgtacgaccgctggctgtccacactgcagggtgtcgaggctgtc
cgcgcggtgctggacatgaagcccgaagccccgtccccggtcatcaccatccgtgagaac
aagatcttgcgcatgccgttgatggacgccgtgcagcacaccaagactgtcaccaagcac
attcagaacaaggagttcgccgaagccatggccctccgcgactcggaattcaaagagtac
cacttttcctacatcaacacttccacgcccgaccacccgaagctgctcctcccagagaac
aagagaatgcgcatcggtattattcacgttggcgcccccgctggtggtatgaaccaggct
acccgcgcggccgttgcctactgcctgactcgtggccacacccccctggccattcacaac
ggtttccccggtctgtgccggcactatgatgacaccccgatctgctctgtgcgcgaggtg
gcatggcaggaatcggacgcctgggtcaacgagggtggttcggatatcggtaccaaccgt
ggtctgcccggcgatgacctcgcgaccacggcgaagagcttcaagaagttcggattcgat
gcgttgttcgtcgtgggtggatttgaggcgttcaccgccgtcagccagcttcgccaggcg
cgcgagaagtaccccgaattcaagattcccatgaccgtgctgccggcgaccatttccaac
aacgtgccgggcacagaatactctctgggtagcgacacctgccttaacaccttgatcgac
ttctgcgacgccatccgccagtcggcctcgtcctctcgtcgccgtgtgttcgtcatcgag
acgcagggtggcaagtcgggttacatcgccacgacggctggtctgtcggtgggcgcggta
gccgtgtacattcccgaggagggcatcgacattaagatgctggcccgcgacattgacttc
ctgcgtgacaactttgcgcgcgacaagggagcgaaccgcgccggtaagatcatcctgcgt
aacgagtgcgcgtccagcacgtacacgacacaggtggtggccgacatgatcaaggaggaa
gccaagggacgtttcgagagtcgtgcggcggtgccgggacacttccagcagggtggcaag
ccgtcgccgatggaccgtatccgggcgttgcggatggccaccaagtgtatgctgcacctg
gagagctatgcgggcaagtcggcggatgagattgcggccgatgagctgtctgcgtcggtc
attggtatcaagggctcgcaggtgttgttctcgccgatgggtggagagaccggcctggag
gcgaccgagacggactgggcgcgccgtcgacccaagacggagttctggctggagctgcag
gacacggtgaacattctgtcgggacgggcgagcgtgaacaacgcgacgtggagttgctat
gagaatgcttaa

DBGET integrated database retrieval system