KEGG   Aspergillus niger: ANI_1_204164Help
Entry
ANI_1_204164      CDS       T01030                                 

Gene name
An18g01670
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ang  Aspergillus niger
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANI_1_204164 (An18g01670)
   01230 Biosynthesis of amino acids
    ANI_1_204164 (An18g01670)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANI_1_204164 (An18g01670)
   00030 Pentose phosphate pathway
    ANI_1_204164 (An18g01670)
   00051 Fructose and mannose metabolism
    ANI_1_204164 (An18g01670)
   00052 Galactose metabolism
    ANI_1_204164 (An18g01670)
  Energy metabolism
   00680 Methane metabolism
    ANI_1_204164 (An18g01670)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ANI_1_204164 (An18g01670)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ANI_1_204164 (An18g01670)
Protein phosphatases and associated proteins [BR:ang01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ANI_1_204164 (An18g01670)
Messenger RNA biogenesis [BR:ang03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ANI_1_204164 (An18g01670)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 783 aa AA seqDB search
MAPPQAPVQPPKRRRIGVLTSGGDAPGMNGVVRAVVRMAIHSDCEAFAVYEGYEGLVNGG
DMIRQLHWEDVRGWLSRGGTLIGSARCMTFRERPGRLRAAKNMVLRGIDALVVCGGDGSL
TGADVFRSEWPGLLKELVETGELTEEQVKPYQILNIVGLVGSIDNDMSGTDATIGCYSSL
TRICDAVDDVFDTAFSHQRGFVIEVMGRHCGWLALMSAISTGADWLFVPEMPPKDGWEDD
MCAIITKNRKERGKRRTIVIVAEGAQDRHLNKISSSKIKDILTERLNLDTRVTVLGHTQR
GGAACAYDRWLSTLQGVEAVRAVLDMKPEAPSPVITIRENKILRMPLMDAVQHTKTVTKH
IQNKEFAEAMALRDSEFKEYHFSYINTSTPDHPKLLLPENKRMRIGIIHVGAPAGGMNQA
TRAAVAYCLTRGHTPLAIHNGFPGLCRHYDDTPICSVREVAWQESDAWVNEGGSDIGTNR
GLPGDDLATTAKSFKKFGFDALFVVGGFEAFTAVSQLRQAREKYPEFKIPMTVLPATISN
NVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVIETQGGKSGYIATTAGLSVGAV
AVYIPEEGIDIKMLARDIDFLRDNFARDKGANRAGKIILRNECASSTYTTQVVADMIKEE
AKGRFESRAAVPGHFQQGGKPSPMDRIRALRMATKCMLHLESYAGKSADEIAADELSASV
IGIKGSQVLFSPMGGETGLEATETDWARRRPKTEFWLELQDTVNILSGRASVNNATWSCY
ENA
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggctcccccccaagctcccgtgcaaccgcccaagagacgccgcatcggtgtcttgacc
tctggtggcgatgctcccggtatgaacggtgtcgtccgggccgtcgtccggatggctatc
cactccgactgtgaggctttcgccgtctacgaaggttacgagggtctcgtcaatggcggc
gacatgatccgtcagcttcactgggaggatgttcgcggctggttgtcccgtggtggtacc
ttgatcggttccgcccgctgcatgaccttccgtgagcgccccggtcgtctgcgggctgcc
aagaacatggtcctccgtggcattgacgcccttgtcgtctgtggtggtgatggcagtttg
actggtgccgacgtttttcgttccgagtggcccggtctgttgaaggaattggtcgagacg
ggcgagttgaccgaagagcaggtcaagccataccagattctgaacatcgtcggtttggtg
ggttcgatcgataacgacatgtccggcaccgacgccaccatcggttgctactcctccctc
actcgcatctgtgacgccgtcgacgacgtcttcgatactgccttttcccaccagcgtgga
ttcgtcattgaggtcatgggtcgtcactgcggttggctggccttgatgtctgctatcagt
accggtgccgactggctgttcgtgcccgagatgccgcccaaggacggatgggaggatgac
atgtgcgctatcattaccaagaacagaaaggagcgtggaaagcgtaggacgatcgtcatc
gtggccgagggtgcccaggatcgccatctcaacaagatctcgagttcgaagatcaaggat
attttgacggagcggttgaacctggatacccgtgtgactgtgttgggtcacactcagaga
ggtggagccgcctgtgcgtacgaccgctggctgtccacactgcagggtgtcgaggctgtc
cgcgcggtgctggacatgaagcccgaagccccgtccccggtcatcaccatccgtgagaac
aagatcttgcgcatgccgttgatggacgccgtgcagcacaccaagactgtcaccaagcac
attcagaacaaggagttcgccgaagccatggccctccgcgactcggaattcaaagagtac
cacttttcctacatcaacacttccacgcccgaccacccgaagctgctcctcccagagaac
aagagaatgcgcatcggtattattcacgttggcgcccccgctggtggtatgaaccaggct
acccgcgcggccgttgcctactgcctgactcgtggccacacccccctggccattcacaac
ggtttccccggtctgtgccggcactatgatgacaccccgatctgctctgtgcgcgaggtg
gcatggcaggaatcggacgcctgggtcaacgagggtggttcggatatcggtaccaaccgt
ggtctgcccggcgatgacctcgcgaccacggcgaagagcttcaagaagttcggattcgat
gcgttgttcgtcgtgggtggatttgaggcgttcaccgccgtcagccagcttcgccaggcg
cgcgagaagtaccccgaattcaagattcccatgaccgtgctgccggcgaccatttccaac
aacgtgccgggcacagaatactctctgggtagcgacacctgccttaacaccttgatcgac
ttctgcgacgccatccgccagtcggcctcgtcctctcgtcgccgtgtgttcgtcatcgag
acgcagggtggcaagtcgggttacatcgccacgacggctggtctgtcggtgggcgcggta
gccgtgtacattcccgaggagggcatcgacattaagatgctggcccgcgacattgacttc
ctgcgtgacaactttgcgcgcgacaagggagcgaaccgcgccggtaagatcatcctgcgt
aacgagtgcgcgtccagcacgtacacgacacaggtggtggccgacatgatcaaggaggaa
gccaagggacgtttcgagagtcgtgcggcggtgccgggacacttccagcagggtggcaag
ccgtcgccgatggaccgtatccgggcgttgcggatggccaccaagtgtatgctgcacctg
gagagctatgcgggcaagtcggcggatgagattgcggccgatgagctgtctgcgtcggtc
attggtatcaagggctcgcaggtgttgttctcgccgatgggtggagagaccggcctggag
gcgaccgagacggactgggcgcgccgtcgacccaagacggagttctggctggagctgcag
gacacggtgaacattctgtcgggacgggcgagcgtgaacaacgcgacgtggagttgctat
gagaatgcttaa

DBGET integrated database retrieval system