KEGG   Aspergillus niger: ANI_1_2048024Help
Entry
ANI_1_2048024     CDS       T01030                                 

Gene name
An02g14800
Definition
protein disulfide-isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ang  Aspergillus niger
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ANI_1_2048024 (An02g14800)
Enzymes [BR:ang01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ANI_1_2048024 (An02g14800)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ANI_1_2048024 (An02g14800)
  Exosomal proteins of colorectal cancer cells
   ANI_1_2048024 (An02g14800)
  Exosomal proteins of bladder cancer cells
   ANI_1_2048024 (An02g14800)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 515 aa AA seqDB search
MRSFAPWLVSLLGASAVVAAADTESDVISLDQDTFESFMNEHGLVLAEFFAPWCGHCKAL
APKYEEAATELKAKNIPLVKVDCTAEEDLCRSQGVEGYPTLKIFRGVDSSKPYQGARQTE
SIVSYMIKQSLPAVSSVNEENLEEIKTMDKIVVIGYIPSEDQETYQAFEKYAESQRDNYL
FAATDDAAIAKSEGVEQPSIVLYKDFDEKKAVYDGEIEQEAIHSWVKSASTPLVGEIGPE
TYSGYIGAGVPLAYIFAETKEEREKYTEDFKPIAQKHKGAINIATIDAKMFGAHAGNLNL
DSQKFPAFAIQDPAKNAKYPYDQAKELNADEVEKFIQDVLDGKVEPSIKSEPVPESQEGP
VTVVVAHSYKDLVIDNDKDVLLEFYAPWCGHCKALAPKYDELAALYADHPDLAAKVTIAK
IDATANDVPDPITGFPTLRLYPAGAKDSPIEYSGSRTVEDLANFVKENGKHNVDALNVAS
EETQEGGDVTEAAPSATEAETPAATDDEKAEHDEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccttcgcgccttggctcgttagccttctcggagcatccgcggtggttgcggct
gctgataccgagtctgatgttatttcactggatcaggacacatttgagagcttcatgaac
gagcacggtctcgtgcttgccgaattctttgctccttggtgtggccactgtaaagccctc
gcaccaaagtatgaggaagcagctacggagctcaaggcgaagaatatccctctggtgaag
gttgactgcaccgccgaggaggatctctgccggagtcagggcgttgaaggctaccctacc
ctcaagatctttcggggtgttgactctagcaagccttaccagggcgctaggcaaacagaa
tcaatcgtttcctacatgattaagcagtcacttcctgcagtatcctccgtgaacgaggag
aatttagaagagatcaagaccatggacaagattgtcgtgatcggttatatcccgtccgag
gaccaggaaacttatcaagcattcgaaaaatatgctgagtctcagcgggataactacctc
tttgctgccacggacgatgccgccattgcgaaatcggaaggtgtcgagcagccctccatc
gtgctctataaggacttcgatgagaagaaggctgtttacgatggcgagatcgaacaggag
gctattcacagctgggtgaaatccgctagtactccccttgtgggcgagattggccctgag
acctactctggctatattggggctggagtcccattggcctatatctttgccgagaccaag
gaggagcgcgaaaagtacaccgaagacttcaagcctattgcccagaagcacaagggtgct
atcaacattgctactattgacgccaagatgttcggtgcccacgctggaaacctcaaccta
gactctcagaagttcccggcattcgccatccaggatcccgcaaagaacgccaaatacccc
tatgaccaggccaaggaattgaatgccgacgaggttgaaaagttcatccaggatgttctg
gatgggaaggtcgagcctagcatcaagtcggaacctgttcccgaatctcaggagggcccc
gtcacggttgtagtggcccattcctacaaggatctcgtcattgacaatgacaaggatgtc
ttgctcgaattctacgcaccttggtgtggacactgcaaagctcttgctccgaagtacgat
gagctcgcagctctctatgctgaccaccccgatttggcggctaaggtcaccatcgctaag
atcgatgcgacggccaacgatgttccggacccgattaccggattccctaccctcagactc
tacccggccggtgccaaggactcccccattgagtactctggctcgcgcactgtcgaggat
cttgccaactttgtgaaggagaatggcaaacacaacgttgacgccctcaatgtcgcttcc
gaggaaacacaggagggtggtgatgtgactgaggctgctccctccgctacggaggccgag
accccggctgccacagatgacgagaaggcagaacatgacgaactgtaa

DBGET integrated database retrieval system