KEGG   Aspergillus niger: ANI_1_2082024Help
Entry
ANI_1_2082024     CDS       T01030                                 

Gene name
An02g14990
Definition
ubiquitin hydrolase
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ANI_1_2082024 (An02g14990)
Peptidases [BR:ang01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ANI_1_2082024 (An02g14990)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ANI_1_2082024 (An02g14990)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 779 aa AA seqDB search
MASCCHVTSEGLRIPASSQVVYREDCTQCFDSIDEEHGLNVCLTCFNGGCAGDRNHAFLH
YERCSHPLALNIKRSRKNVQRDEPPQKISKLAIAAETDEDRYVTKTRVVCYPCCQNDLDA
SRGRLPAVIDGVMKAMTFSKREEVKAWEQEFIPCEHTINLIQGASRQIESKELVQCSMCN
LKENLWLCLECGNLGCGRSQFGGVGGNSHALAHSDIKSHAVAVKLGSITADGSADVYCYR
CNEERTDPNLATHLANWGINLAGREKTEKSLMEMQVEQNMRWEFSMTSEDGHELTPVFGP
GLTGLTNLGNSCYLSSVVQCLFALPEFQKRYYHPNSEPPHTQRPAEDLETQLRKLADGIL
SGRYSRPDSDVRSSPDSAEVPHQKGLAPAMFKHLVGRNHEEFSTMRQQDAFEFMLHLFKQ
INLSKHPGGLDNPITSFGFSMQQRLQCLQCKKVRYRADAQDNISIPVPARRLPDANASGS
TNEYESVTLAECLDAFTAEEVVEFSCPSCGSTEGFNKQSSFKTLPQKLVINARRFELINW
VPTKLNIPVEVDEEPIDFGTYLSSGPNPDEELLPDIQEPENTFKPNEIAMEQLVGMGFPN
TRCERALYVTGNSDVEAAMNWLFAHMEDPDIDEPLDKVVTSTSGSQQDPAKVAQLTEMGI
NSGHARRALAATEGDLNRAIDWVFTHPEDSMDIGSDSDIPESSDIHLDSDATPAKYQLQS
IVCHKGSSVHAGHYVAIVRKAVPGSNGTRWVMFNDEKVVQVDDIQEMKKFAYIYVFSRT
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttgttgccatgtcacgtctgaagggctgaggattccagcttcgtcgcaggtt
gtatatcgggaagactgtacacagtgtttcgactcaatagatgaggaacatggtcttaat
gtttgcttaacatgtttcaatggaggctgcgctggtgatagaaatcatgcctttctccac
tatgaacgttgcagtcaccctctagcgctcaatattaaaagatcacgtaaaaacgtccag
agggatgagccaccacagaagatttcgaagcttgcaatcgccgctgaaaccgatgaggac
cgttatgtcacgaaaacacgtgttgtctgttatccttgctgtcagaatgatctcgatgca
tccagaggtaggctgccagctgtaattgacggcgtgatgaaagcgatgaccttctccaaa
agagaggaagtcaaggcctgggagcaggagttcatcccctgcgagcataccataaatcta
atccagggagcgtcaagacagattgaatctaaggagctagtccagtgttccatgtgtaac
ctgaaagagaacctctggctatgtctagaatgcggcaaccttggctgcggtcgcagtcag
tttggcggagttggaggaaactcgcatgcacttgcgcattctgacataaaatcgcatgcc
gttgcagtgaagctgggttctataactgcagatggctcggcagacgtgtactgctataga
tgcaacgaagaaaggaccgatcctaacctggctactcatcttgctaattggggcatcaat
ctagcgggccgtgagaagacagagaaaagccttatggagatgcaggttgagcaaaatatg
agatgggaattttcgatgacttctgaggacggccatgaacttacaccggtgtttgggcca
ggattaaccggcttgactaacttaggaaacagttgttatctctcaagtgttgtccaatgc
cttttcgccttgcctgagttccaaaaacgatattaccatcctaacagcgagccgccgcac
acgcaaaggccagcggaggaccttgaaacccaactgcggaagctggccgacggcatcctc
tctggcagatactccagacccgatagcgatgtcaggtcttcccctgattcagctgaagtt
cctcatcaaaagggcttagcacccgccatgttcaagcatctcgttggccgtaatcatgaa
gaattctctacgatgagacaacaggatgcgttcgagttcatgcttcacctcttcaagcag
ataaacttgtccaagcatcccggaggattagataacccaatcacctcgttcggcttctct
atgcaacagcgtctccaatgtttgcagtgcaagaaggttcgttacagggctgacgcacaa
gataacatttcgatccctgttcccgctcgtcggctccccgatgcaaatgcttctggctcc
acaaacgagtatgagagtgtcactctagcagaatgtctggatgcttttacagccgaggaa
gttgttgaattcagctgcccgtcctgcggttccacggaggggttcaataagcaatcttca
ttcaaaaccctaccgcagaaactggttattaatgcgcggaggttcgaactgataaattgg
gtacccacaaagttgaatattccggtagaagttgatgaggagccaatagactttggtact
tacctttcctccgggcccaatccagatgaggagcttctccctgacattcaggaacctgaa
aatacgtttaagcccaatgaaattgcgatggaacagcttgtcggcatgggttttccgaat
acaaggtgcgaaagggcgctttatgtgaccggcaactcggatgttgaggctgctatgaac
tggctctttgctcacatggaagaccctgatatcgacgagccgctcgataaggtggttacc
agcacctcagggagccagcaagacccagctaaggttgcgcagttgactgaaatgggcata
aattctggtcatgctaggagggcattggcagcgacggagggggatctcaacagggcaatt
gattgggtgttcacccatccggaggattcaatggacatcggttcagactctgacatccct
gaatccagtgatatacatctagactctgatgccacgccagcaaaataccaattgcaatca
atagtgtgccacaaaggctcatctgtgcatgctgggcactatgtcgcaattgtgcgtaag
gccgtgccaggaagtaatggtactcggtgggtcatgttcaatgatgagaaggttgttcag
gtggatgacatacaagagatgaagaagttcgcatatatttacgtattctctcggacctaa

DBGET integrated database retrieval system