KEGG   Aspergillus niger: ANI_1_212154Help
Entry
ANI_1_212154      CDS       T01030                                 

Gene name
An17g01530
Definition
alcohol dehydrogenase 2
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ang  Aspergillus niger
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ang01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ang00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ang00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ang00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 350 aa AA seqDB search
MTIPEKQWAQVVEKKGGPPVYKQIPVAKPGPDEILVKIRYTGVCHTDLHAMKGDWPLGLK
LPLVGGHEGAGVVVATGDLVNEFEVGDHAGIKWLNGSCLACEFCKQAEEPLCPHALLSGY
TVDGTFQQYAIAKASHASKLPKEVPLDAVAPILCAGITVYKGLKESGARPGQTVAIVGAG
GGLGSLALQYAKAMGLRTIAIDGGDEKKAMCEKLGSEAYIDFKTSKDVVEDVKAATPEGL
GAHAVILLAVAEKPFQQATEYVRSKGSVVAIGMPAGAFLRAPVFNTVVRMINIKGSYVGN
RQDGVEAVDFFARGLIKAPFKTAPLEDLPRIFELMEQGQIAGRYVLEVPQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactatcccggagaagcaatgggcccaagtggtcgagaagaagggtggaccccctgtc
tacaagcagattccggtggcaaagcctggcccggacgagatcttggtcaagatccggtat
accggggtttgccataccgacttgcacgccatgaagggtgactggccactcgggttgaag
cttcccctcgtgggcggacatgaaggagctggcgtggtcgtcgccacgggtgacctcgtc
aatgagttcgaagttggagatcacgctggtatcaaatggttgaacggatcctgtttggct
tgtgagttctgcaagcaggccgaggagcccctgtgtcctcacgcgttgctatccggttac
accgtcgatggtacgttccagcagtatgccatcgccaaggccagtcatgcgtcgaagctc
ccgaaggaagttccccttgatgctgtcgctcccatcctctgtgctggtatcactgtctac
aagggattgaaggagtctggtgctcgtcccggccagaccgtcgccattgtcggcgccgga
ggtggactcggatcgctggctctgcagtatgctaaggcaatggggcttcgcaccatcgcc
atcgacggtggtgacgagaagaaagctatgtgcgagaaactcggatcggaggcatacatc
gactttaagacatccaaggatgtagttgaggacgtcaaggcagccactccggaaggcctt
ggtgcccacgctgtgattcttctcgctgtggccgaaaagcccttccagcaggcaaccgag
tacgttcgctccaagggtagtgtcgtcgctattggcatgccagccggcgcattccttcga
gcccctgtcttcaacaccgttgtccgtatgatcaacatcaagggaagctacgttggcaat
aggcaggatggcgtagaagcagtagacttctttgcccgcggactcatcaaggctccgttc
aagacggctcctttggaggatttgccgcgcatcttcgaactgatggaacaaggccagatc
gccggtcggtatgtccttgaggtgcctcagtaa

DBGET integrated database retrieval system