KEGG   Aspergillus niger: ANI_1_2138074Help
Entry
ANI_1_2138074     CDS       T01030                                 

Gene name
An08g07600
Definition
(RefSeq) possible replication factor-a protein
  KO
K10739  
replication factor A2
Organism
ang  Aspergillus niger
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ANI_1_2138074 (An08g07600)
   03420 Nucleotide excision repair
    ANI_1_2138074 (An08g07600)
   03430 Mismatch repair
    ANI_1_2138074 (An08g07600)
   03440 Homologous recombination
    ANI_1_2138074 (An08g07600)
DNA replication proteins [BR:ang03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    ANI_1_2138074 (An08g07600)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     ANI_1_2138074 (An08g07600)
   MMR (mismatch exicision repair)
     ANI_1_2138074 (An08g07600)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     ANI_1_2138074 (An08g07600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 288 aa AA seqDB search
MDGGYNNYSSTYSGGGGGGGGFMPGEMNNSPSGGKSDYTNSTLRPITIKQALDAVQPYPE
APYQIDSAEISSICFIGQVRNISSQSTNVTYKIDDGTGEIEAKQWIDSMTADSMDTDDIN
NTKAATGRRDGKVELNGYAKVFGKLKSFGNKRFVGAHCVRPVKSLDEVHCHLLEASAVHL
FFTRGPPGGGASGAGGVGDVGAKGDAAMGGTGDDYGAGKNLPAMSPVAKRVYQLLRTEPQ
SNEGLHAQLIAAKLSLPMPDVARAGDELLTAGVIFSTVDEQTWAILEF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggacggcggctacaacaactacagcagcacctacagcggcggtggtggcggcggcggc
ggcttcatgccgggcgagatgaacaacagcccatccggaggaaagtccgactacaccaac
tccaccctccgccccataaccatcaaacaagctctggacgcagttcagccatacccggaa
gcgccctaccaaatcgactccgccgaaatctccagcatctgcttcatcggacaagtacgc
aacatcagctcgcaaagcacaaacgtcacatacaagatcgacgacggcacaggcgagatc
gaagccaagcaatggatcgactccatgacggccgactccatggacacggacgacatcaac
aatactaaggccgccaccggcaggagagacggtaaggtagagttgaacgggtacgcgaag
gtgttcggaaagttgaagtcgtttgggaataagaggtttgtgggtgcgcattgcgtccgc
cctgttaagagtctggatgaggtgcattgtcatttgttggaggcgagtgctgtgcatttg
tttttcacgagggggccgcctgggggtggtgcctctggtgctgggggagtgggtgatgtg
ggtgctaagggggatgcggcaatgggaggtacaggggatgactacggggctggaaagaat
ctgcctgctatgagtcctgttgcgaagagagtgtatcaattgcttaggacggagccgcag
agcaatgaggggttgcatgcgcagttgattgcggcgaagctgagtttgccgatgccggat
gtggccagggcgggagatgagttgctcactgcgggtgtgatcttttcgacggtggatgag
cagacgtgggcgattttggagttttaa

DBGET integrated database retrieval system