KEGG   Aspergillus niger: ANI_1_2138074Help
Entry
ANI_1_2138074     CDS       T01030                                 

Gene name
An08g07600
Definition
possible replication factor-a protein
Orthology
K10739  
replication factor A2
Organism
ang  Aspergillus niger
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ANI_1_2138074 (An08g07600)
   03420 Nucleotide excision repair
    ANI_1_2138074 (An08g07600)
   03430 Mismatch repair
    ANI_1_2138074 (An08g07600)
   03440 Homologous recombination
    ANI_1_2138074 (An08g07600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 288 aa AA seqDB search
MDGGYNNYSSTYSGGGGGGGGFMPGEMNNSPSGGKSDYTNSTLRPITIKQALDAVQPYPE
APYQIDSAEISSICFIGQVRNISSQSTNVTYKIDDGTGEIEAKQWIDSMTADSMDTDDIN
NTKAATGRRDGKVELNGYAKVFGKLKSFGNKRFVGAHCVRPVKSLDEVHCHLLEASAVHL
FFTRGPPGGGASGAGGVGDVGAKGDAAMGGTGDDYGAGKNLPAMSPVAKRVYQLLRTEPQ
SNEGLHAQLIAAKLSLPMPDVARAGDELLTAGVIFSTVDEQTWAILEF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggacggcggctacaacaactacagcagcacctacagcggcggtggtggcggcggcggc
ggcttcatgccgggcgagatgaacaacagcccatccggaggaaagtccgactacaccaac
tccaccctccgccccataaccatcaaacaagctctggacgcagttcagccatacccggaa
gcgccctaccaaatcgactccgccgaaatctccagcatctgcttcatcggacaagtacgc
aacatcagctcgcaaagcacaaacgtcacatacaagatcgacgacggcacaggcgagatc
gaagccaagcaatggatcgactccatgacggccgactccatggacacggacgacatcaac
aatactaaggccgccaccggcaggagagacggtaaggtagagttgaacgggtacgcgaag
gtgttcggaaagttgaagtcgtttgggaataagaggtttgtgggtgcgcattgcgtccgc
cctgttaagagtctggatgaggtgcattgtcatttgttggaggcgagtgctgtgcatttg
tttttcacgagggggccgcctgggggtggtgcctctggtgctgggggagtgggtgatgtg
ggtgctaagggggatgcggcaatgggaggtacaggggatgactacggggctggaaagaat
ctgcctgctatgagtcctgttgcgaagagagtgtatcaattgcttaggacggagccgcag
agcaatgaggggttgcatgcgcagttgattgcggcgaagctgagtttgccgatgccggat
gtggccagggcgggagatgagttgctcactgcgggtgtgatcttttcgacggtggatgag
cagacgtgggcgattttggagttttaa

DBGET integrated database retrieval system