KEGG   Aspergillus niger: ANI_1_2152104Help
Entry
ANI_1_2152104     CDS       T01030                                 

Gene name
An12g08370
Definition
ubiquitin carboxyl-terminal hydrolase 6
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ANI_1_2152104 (An12g08370)
Peptidases [BR:ang01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ANI_1_2152104 (An12g08370)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 574 aa AA seqDB search
MASIPVVVKHQGKRYEVELDPSLNGETLKYQLFSLTGVEPERQKILVKGGQLKDDTPLSS
LNAKPGQTFMMMGTPSGGQGAGDLGRPKEVVKFLEDMTEAEAARAEGATPAGLQNLGNTC
YLNSTLQTLRSVPELQDALLKYRPSGGSSGGSSLSNLSSLGLGGLGASMDLTSSLRDLFK
QMSETQEGFPPLMFLNALRNAFPQFAQRDRNGHGYAQQDAEEAWSQIVSQLRNKLVVKEG
EGDSAAEVSFVDKYMAGGFESTTECDEKAAKEAGEEPTNSSDVFYKLDCHIGKETNHLHD
GIMAGLEEKIEKRSSTLDRDAVYTKRSRIARLPKYLTVHFVRFFWKRETQKKAKIMRKVT
FPAELDAVDFCTDELKKQLIPVRDKVREIRKEEVDVERARKRQKLAHRKEEEEKKEAESG
ASMEPMQKKKAAEERKGESKAAEKDGDEAMTDVFKSDADYEAEKTASILAAKKELSELID
PSLASDSGVNKTGLYELRGVITHQGASADSGHYTAYVKKQSSSDGASTEDKWWWFNDEKV
TEVEGDKIETLAGGGESHSALILLYRAVEVPTTN
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcttctatacctgttgttgtaaagcaccagggcaaacgctacgaggtggagctcgat
ccttccctgaatggcgaaacgctcaaataccagctattttctctcactggcgtcgaaccc
gagcggcagaagatcctagtcaagggaggccagcttaaagatgatacacctctgtcctcc
ctcaacgccaaacccggccaaacgttcatgatgatgggcactccgtcgggcggtcaaggt
gctggagacttgggtagaccaaaggaagtcgtcaagtttttggaagacatgacggaagct
gaagctgccagggcggagggtgcaactcctgcaggtctgcagaaccttggaaatacttgc
tacctgaactcaacgctacagacactacggagcgttcccgaactccaggatgcgctgctc
aaataccgaccttctgggggctcttctggaggttctagcctttcgaacctcagtagtctc
ggtcttggcggcttgggagcttctatggatctcacgtcctctctgcgggacctcttcaag
caaatgtcggagacgcaggaaggtttcccgccgcttatgtttctcaacgcgcttcgaaat
gctttcccccaatttgctcaaagggatcgcaatggacatggctatgctcaacaggatgcc
gaagaggcctggtcacagatcgtgagtcagctgcgtaacaagctggtcgtgaaggagggt
gaaggtgactctgccgccgaagtttccttcgtggataagtacatggccggagggtttgag
tccaccaccgaatgcgacgaaaaggccgcaaaggaggctggtgaagaacctactaatagc
tccgatgtgttttacaagcttgattgtcatattggtaaagagactaaccatttgcacgac
ggtattatggctggtctcgaggagaagatcgaaaagcggtcctctactcttgaccgcgat
gccgtatataccaaacgttcacgcattgcgcgcttgcccaagtacttgacggtgcatttc
gttcggttcttctggaagcgcgaaacacagaagaaggccaagattatgcgaaaggtcaca
ttccccgctgagcttgatgcggtggacttctgcaccgacgaattgaaaaagcagctcatt
cctgtgagagacaaggtccgtgagattcggaaggaagaggtggatgttgaacgtgctcgt
aagcgtcaaaagctcgctcaccggaaagaggaggaagaaaagaaagaggccgagtccggg
gcaagcatggagccgatgcagaagaagaaagctgctgaagagcgcaagggagagtctaaa
gccgcggagaaagacggagatgaggccatgaccgatgtgttcaagtccgatgcagactac
gaagctgagaagaccgcctcgattctcgcggctaagaaagaattgtctgagctcattgac
cccagtcttgcctcagacagcggtgtgaacaagacgggtctctacgaactacgcggagtg
atcacacatcagggtgcaagtgcagacagcggacattacaccgcgtacgtgaaaaagcag
tccagcagtgatggtgcaagcaccgaagacaagtggtggtggttcaacgatgagaaggtt
accgaagtggaaggggacaagattgagacgcttgctggtggtggtgaatcccattctgca
cttattctcctctaccgggctgttgaggtgccgacgacgaattaa

DBGET integrated database retrieval system