KEGG   Aspergillus niger: ANI_1_216174Help
Entry
ANI_1_216174      CDS       T01030                                 

Gene name
An10g00780
Definition
carboxylesterase
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
ang  Aspergillus niger
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 597 aa AA seqDB search
MGSQAAYPSAQISVKMHGTRGSTVRGSILRRIAASIKVLSLPKHLESLPYHRDHPIDPTL
AFNHTMDQSRRARLALATLIPLLTGANAALYDTVIDTQYGGVQGYPAFTSEPAGNLTHWK
DITVWKNIPFAATTGGQNRWKAPQPVSAWNGTRDAKSFGNVCPSATQGSSEYTIDEDCLN
LNIWSPANSTDAKLPVVMWSYPALSTAADALFDGGGMADQGIVFVNYNYRTGSFGWMAHP
ELSEEFYKVTGSNSSGNWGMLDQFAALKWIHENIAAFGGDPEHITVMGQSAGSAATQHIL
NSPLTKGLIVGAIIESGVRDPHDPLCTSLAEGYSTLEDQLAQGERFMASLNCSSIAEMRE
LPMEDLVVSGGTFGSTSEWSFGATLDYYAMPDTYYNTLIKGLAQDVPVITGNTKDESGAS
YGLNLTVSEYLADMNETFSEPWLSRFLELYPGNTTRTAPGAYNSQWTDRSKVGTWLWAQL
WATARTSPVYTYFWDHAPPGQDQGAYHESEINYVLNNLYGTDLPWTAADYSIARKMNGYW
ANFIKTGNPNGGSLTQWPATGENAKVQHVGDGWGEIPTASDAKVKLFEEWFDTLKTY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgcaggccgcgtatccctcggcgcaaatatccgtgaagatgcatggcacccgt
gggagcaccgttagggggtccattctccgacgcattgcggcatctattaaagtgctgtct
ctccccaagcatctcgaatcattaccttaccatcgtgaccatcccattgatcccacatta
gcgttcaaccacacgatggatcagtcacgccgtgcgagactcgctctcgccacgcttatt
cctctcctgaccggggccaatgcagcgctctatgacactgtcatcgacacgcagtatggt
ggtgttcaaggctacccagccttcaccagcgagccggccggtaacctaacccattggaaa
gacattaccgtctggaagaacatcccctttgccgccaccaccgggggtcaaaaccgctgg
aaggcaccccagcccgtcagcgcttggaacggcacccgtgatgcgaagtctttcggaaac
gtatgcccgtcggccacccagggcagctccgaatataccatcgacgaagactgcttgaac
ctcaacatatggagtcccgccaactcgacggacgcaaagctcccggttgtcatgtggagc
tatcccgctctgtcgacggctgcggatgccctcttcgatggtggcggcatggctgaccag
ggtatcgtttttgtgaactacaactaccgcacaggctcattcggctggatggcgcacccg
gagttgtcggaggagttctacaaggtgaccggatccaacagctccggcaactggggcatg
ctcgaccaatttgcagcgctcaagtggatccatgagaacatcgccgcgtttggcggtgat
cccgaacacatcacggttatgggccagtctgctgggtcggctgccacccagcacatcctc
aacagcccattgaccaagggcctgatcgtcggcgccatcatcgaaagtggagttcgggat
ccgcacgatcccctctgcaccagtctggcggaaggctacagcacattggaggaccagctg
gcccagggagaacgcttcatggccagcttgaactgcagctccatcgccgagatgcgcgaa
ctgcccatggaggatctcgtcgtgtcgggcggaacattcggcagcaccagcgaatggagc
ttcggggccactttggactactacgcaatgccggacacctactacaacacgctcatcaag
ggtctggcgcaggacgtgcctgtcattacgggcaacaccaaggacgaaagtggggccagc
tacggcctgaacctcaccgtgtccgagtacctggcagacatgaacgagacgttcagcgag
ccatggctctctcgctttctggagctgtatcccggaaacaccacacgaaccgccccggga
gcctacaactcccagtggaccgaccggtccaaagtgggcacttggctgtgggcacagctc
tgggcgaccgcgaggaccagtcctgtgtatacctacttctgggaccacgctcccccaggc
caggaccagggcgcgtaccacgaatccgagattaactatgttctgaacaacctgtacggc
acggacctgccatggacggcggccgactactccatcgcacggaagatgaacggatactgg
gccaacttcatcaagacgggcaatcccaatggaggatccctgacccagtggcctgccacg
ggagagaacgcgaaggtgcagcatgtgggtgatggatggggagagattccgaccgcatct
gatgccaaggtgaagctgtttgaggagtggttcgacacactgaagacttactaa

DBGET integrated database retrieval system